Protein Info for Dsui_2040 in Dechlorosoma suillum PS

Annotation: putative CoA-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13380: CoA_binding_2
  • amino acids 15 to 129 (115 residues), 154.5 bits, E=7.5e-50

Best Hits

Swiss-Prot: 54% identical to YCCU_ECOLI: Uncharacterized protein YccU (yccU) from Escherichia coli (strain K12)

KEGG orthology group: K06929, (no description) (inferred from 67% identity to azo:azo0744)

Predicted SEED Role

"O-acetylhomoserine sulfhydrylase (EC 2.5.1.49) / O-succinylhomoserine sulfhydrylase (EC 2.5.1.48)" in subsystem Methionine Biosynthesis (EC 2.5.1.48, EC 2.5.1.49)

MetaCyc Pathways

• aspartate superpathway (22/25 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (15/18 steps found)
• superpathway of L-methionine biosynthesis (by sulfhydrylation) (10/12 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (12/15 steps found)
• superpathway of sulfur amino acid biosynthesis (Saccharomyces cerevisiae) (8/10 steps found)
• superpathway of L-cysteine biosynthesis (fungi) (5/6 steps found)
• L-homocysteine biosynthesis (2/2 steps found)
• L-methionine biosynthesis III (3/4 steps found)
• homocysteine and cysteine interconversion (3/4 steps found)
• L-methionine biosynthesis II (4/6 steps found)
• superpathway of S-adenosyl-L-methionine biosynthesis (6/9 steps found)
• superpathway of L-methionine biosynthesis (transsulfuration) (6/9 steps found)
• S-methyl-5-thio-α-D-ribose 1-phosphate degradation III (3/5 steps found)
• superpathway of L-homoserine and L-methionine biosynthesis (5/8 steps found)
• S-methyl-5-thio-α-D-ribose 1-phosphate degradation II (2/5 steps found)
• L-methionine biosynthesis I (2/5 steps found)

KEGG Metabolic Maps

• Biosynthesis of plant hormones
• Cysteine metabolism
• Methionine metabolism
• Selenoamino acid metabolism
• Sulfur metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.48, 2.5.1.49

Use Curated BLAST to search for 2.5.1.48 or 2.5.1.49

Sequence Analysis Tools

See G8QIJ9 at UniProt or InterPro

Protein Sequence (152 amino acids)

>Dsui_2040 putative CoA-binding protein (Dechlorosoma suillum PS)
MSELATLRQVLKENRTIAVVGLSADWNRPSYFAAKYMQERGYRIIPVNPKYPEILGEKCY
PDLKSIPEKVDIVDVFRKPEDCVPIAREAVAIGAKVFWMQLGVINEEARHIAEAAGLTVV
EDRCVKIEYARLFGGLNFMGVNTGIVSSRRPT