Protein Info for Dsui_2032 in Dechlorosoma suillum PS

Annotation: PAS domain S-box/diguanylate cyclase (GGDEF) domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 876 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 283 to 306 (24 residues), see Phobius details PF02743: dCache_1" amino acids 36 to 271 (236 residues), 59.4 bits, see alignment E=1.8e-19 PF22588: dCache_1_like" amino acids 186 to 271 (86 residues), 39.7 bits, see alignment E=2e-13 TIGR00229: PAS domain S-box protein" amino acids 324 to 442 (119 residues), 51.5 bits, see alignment E=1.1e-17 PF13188: PAS_8" amino acids 327 to 386 (60 residues), 32.1 bits, see alignment 3.5e-11 PF00989: PAS" amino acids 328 to 435 (108 residues), 36.7 bits, see alignment E=1.7e-12 PF08448: PAS_4" amino acids 333 to 440 (108 residues), 43.3 bits, see alignment E=1.8e-14 PF13426: PAS_9" amino acids 338 to 436 (99 residues), 34.5 bits, see alignment E=9.3e-12 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 446 to 609 (164 residues), 160.8 bits, see alignment E=2.5e-51 PF00990: GGDEF" amino acids 449 to 605 (157 residues), 171.3 bits, see alignment E=6.5e-54 PF00563: EAL" amino acids 626 to 853 (228 residues), 226.5 bits, see alignment E=1.4e-70

Best Hits

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QIJ1 at UniProt or InterPro

Protein Sequence (876 amino acids)

>Dsui_2032 PAS domain S-box/diguanylate cyclase (GGDEF) domain-containing protein (Dechlorosoma suillum PS)
MSAKRPKLYLVFFILAVLGTVVPAAFLLGSAYYSEHRQAAQDARNVSGVLEARLEATLRR
IESNLGELVADLPRQALHPKAFSRYGEAMQRQLAMRASHFPEIVGLRIIDAEGNVLYASD
VTRPRVNVADRSYFQALRREPQTRLFFSEVAVGRISGRTQLVVAMPIRRADGSFAGVAMA
PLDMRYFQQLFDAIDLGPRGVITFRRSDDGRLVLRRPERPGTVNQTLSNNPMHLRVEAGE
REGVISYRAALDQMERVYAFKRIGDFPFYVAVGIAAKDFLAPWYLTLGITSGVELIFLAG
LGLLLWRLDRAERRRAAASQALASSERRFQQLLDSAGEGICGLDRQGRLTFANPAARRLL
GFGEELPRGDFLQQVHADDAGAALRTCLEEDRSVHSDDALFARADGSRFPVQYDLYPLAQ
EAGVAQGAVLLFADIAERKRHADQIEYLAHHDALTGLPNRLLAEDRFNQALAAASRRGEQ
VALLFLDLDGFKTINDSLGHEVGDKVLRAVADRLRSHLRESDTVSRFGGDEFLVIMPGLQ
QVEVIYPVIGKLLACLEQPLALEHYQLSTSVSIGVAVFPHDGRDFTTLMQKADTAMYHAK
DAGRNTYRLFDEAMNLHAQETLRLRNNFQRGLDGDEFVLHLQPQVVGAEALVRWQDGSRL
IAPAHFIPVAESSGFIVPLGQWVLRESCRLAARWQRELGREVTIAVNISAIQFKRGDLER
TVAEALAESGLPPHLLELELTESTLLNQTESVLSTLRTLRDQGVRLSIDDFGTGYSSLAY
LKRLAVNKLKIDQSFVRNLDGDAEDAAIVRAIIEMAHRLNLRTVAEGVETVEVLQSLRRF
ACDEAQGYYFARPLPVDEFERFLASWPGLLPGRMAY