Protein Info for Dsui_2008 in Dechlorosoma suillum PS

Annotation: tetratricopeptide repeat protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 195 PF13181: TPR_8" amino acids 76 to 104 (29 residues), 13.1 bits, see alignment 4.6e-05 amino acids 107 to 137 (31 residues), 27.4 bits, see alignment 1.2e-09 amino acids 142 to 165 (24 residues), 12.8 bits, see alignment (E = 5.8e-05) PF13432: TPR_16" amino acids 77 to 137 (61 residues), 42.2 bits, see alignment E=4.3e-14 amino acids 120 to 167 (48 residues), 32.6 bits, see alignment E=4.5e-11 PF07719: TPR_2" amino acids 107 to 137 (31 residues), 24.8 bits, see alignment 7.9e-09 PF00515: TPR_1" amino acids 107 to 139 (33 residues), 28.5 bits, see alignment 4.7e-10 PF13414: TPR_11" amino acids 119 to 152 (34 residues), 29.9 bits, see alignment 1.9e-10

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QIG8 at UniProt or InterPro

Protein Sequence (195 amino acids)

>Dsui_2008 tetratricopeptide repeat protein (Dechlorosoma suillum PS)
MLLGPWSYRLHGWLLHFLGRDGAAYAAYQEAFRHTPGAATAACLGYLAARLERLEDAEAW
YASAASLAPERGEHHFNLGYVRDRLGRPRQAIAAFHAALHLNPQLDRAWYGKGLAHATLG
EHEAAATALEKAVELQPMNGIAYYHLGMAYHHAGRHQESERIARRLAAFEPRLARQLMRD
GEHPQLLSLVAHLEA