Protein Info for Dsui_2001 in Dechlorosoma suillum PS

Annotation: hydro-lyase, Fe-S type, tartrate/fumarate subfamily,hydro-lyase family enzyme, Fe-S type, tartrate/fumarate subfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 510 PF05681: Fumerase" amino acids 11 to 289 (279 residues), 323.9 bits, see alignment E=7.8e-101 TIGR00722: hydrolyase, tartrate alpha subunit/fumarate domain protein, Fe-S type" amino acids 12 to 288 (277 residues), 216.7 bits, see alignment E=3.5e-68 PF05683: Fumerase_C" amino acids 293 to 494 (202 residues), 286.1 bits, see alignment E=1.3e-89 TIGR00723: hydrolyase, tartrate beta subunit/fumarate domain protein, Fe-S type" amino acids 331 to 492 (162 residues), 160.1 bits, see alignment E=4.9e-51

Best Hits

KEGG orthology group: K01676, fumarate hydratase, class I [EC: 4.2.1.2] (inferred from 93% identity to dar:Daro_1627)

Predicted SEED Role

"Fumarate hydratase class I, aerobic (EC 4.2.1.2)" in subsystem Serine-glyoxylate cycle or TCA Cycle (EC 4.2.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.2

Use Curated BLAST to search for 4.2.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QIG1 at UniProt or InterPro

Protein Sequence (510 amino acids)

>Dsui_2001 hydro-lyase, Fe-S type, tartrate/fumarate subfamily,hydro-lyase family enzyme, Fe-S type, tartrate/fumarate subfamily (Dechlorosoma suillum PS)
MSSIRQEDLIQSIADAFQYISYYHPLDYIKALGEAYEREESPAAKDAIAQILTNSRMAAE
GHRPICQDTGIGMVFLKVGMNVRWDDATMSLQEMVNEGVRRAYANPDNPLRASVLADPAG
ARKNTKDNTPAVVHFEIVPGDHVEVICAAKGGGSEAKSKFAMLNPSDDLVDWVLKKIPEM
GAGWCPPGIIGIGIGGTPEKAMLLAKESIMAPVDIHDLQDKAKSGAKLTRAEELRLELYE
KVNALGVGAQGLGGLTTVLDVKVLDYPCHAANLPVALVPNCAATRHCHFHLDGSGPAKIE
PPKLEDWPAVTWTPDLKAATQVNLDTLTKEEVASWKPGQKLLLNGKMLTGRDAAHKRIAD
MLAKGEKLPVDFTNRVIYYVGPVDPVRDEVVGPAGPTTATRMDKFTRMMLEKTGLISMIG
KSERGPVAIEAIKDNKSAYLMAVGGAAYLVAKAIKSAKVVGFADLGMEAIYEFEVQNMPV
TVAVDSSGTSVHETGPKEWQVKIGKIPVKA