Protein Info for Dsui_1996 in Dechlorosoma suillum PS

Annotation: PhoH family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 480 PF13638: PIN_4" amino acids 26 to 171 (146 residues), 129.2 bits, see alignment E=2e-41 PF02562: PhoH" amino acids 267 to 468 (202 residues), 158.2 bits, see alignment E=3e-50 PF13604: AAA_30" amino acids 271 to 434 (164 residues), 27.3 bits, see alignment E=4.2e-10

Best Hits

KEGG orthology group: K07175, PhoH-like ATPase (inferred from 79% identity to app:CAP2UW1_2265)

Predicted SEED Role

"Predicted ATPase related to phosphate starvation-inducible protein PhoH" in subsystem Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QI14 at UniProt or InterPro

Protein Sequence (480 amino acids)

>Dsui_1996 PhoH family protein (Dechlorosoma suillum PS)
MARKPAASSKTVASSSSTASSRCKIFVLDTNVLMHDPTSLFRFEEHDVFLPMMVLEELDN
NKKGMSEISRNARQASRTLDDILAHAGDEIEGGISLETPSSKLATGHLFLQTEAISSELP
QALPTSKYDNQILAVVFHLQRRYPKRSVILVSKDINMRIKARTLGLAAEDYFNDKVLEDT
DLLYTGVRELPADFWDKHGQGMESGKREGRTYYRIKGPLCSHLLVNEFVYQEGPQPLYAL
VRNVSGKSAELETLIDFTHPKNNVWGITARNREQNFALNLLMDPEVDFITLLGQAGTGKT
LLTLAAGLTQVLETKQYSEIIMTRVTVPVGEDIGFLPGTEEEKMAPWMGALEDNLDVLNK
TDDEAGDWGRAATRDLIRSRIKVKSLNFMRGRTFINKYLIIDEAQNLTPKQMKTLITRAG
PGTKVVCLGNIAQIDTPYLTEGSSGLTYVVDRFKGWTHSGHITLQRGERSRLADHAAEVL