Protein Info for Dsui_1981 in Dechlorosoma suillum PS

Annotation: 23S rRNA (uracil-5-)-methyltransferase RumA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01938: TRAM
  • amino acids 5 to 51 (47 residues), 26.5 bits, 6.9e-10
• TIGR00479: 23S rRNA (uracil-5-)-methyltransferase RumA
  • amino acids 9 to 423 (415 residues), 305.7 bits, E=2.6e-95
• PF05958: tRNA_U5-meth_tr
  • amino acids 254 to 331 (78 residues), 30.4 bits, E=3.3e-11
  • amino acids 355 to 430 (76 residues), 35.1 bits, E=1.2e-12
• PF13847: Methyltransf_31
  • amino acids 283 to 361 (79 residues), 32.2 bits, E=1.2e-11

Best Hits

Swiss-Prot: 68% identical to RLMD_DECAR: 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD (rlmD) from Dechloromonas aromatica (strain RCB)

KEGG orthology group: K03215, RNA methyltransferase, TrmA family [EC: 2.1.1.-] (inferred from 72% identity to app:CAP2UW1_3077)

Predicted SEED Role

"23S rRNA (Uracil-5-) -methyltransferase RumA (EC 2.1.1.-)" (EC 2.1.1.-)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

See G8QHZ9 at UniProt or InterPro

Protein Sequence (431 amino acids)

>Dsui_1981 23S rRNA (uracil-5-)-methyltransferase RumA (Dechlorosoma suillum PS)
MPVGKIESLDHDARGVTRLEGKTVFVEGALPGETVEYALFREKPNYAVGEVSAVLRPSCA
RVPPRCPHFGTCGGCSMQHLEPTAQVAAKQRLLENNLWHLARLKPEQVYNPIYGPTWGYR
HRARLTVRMVESKGMLVGFHEKRSSYVADLHTCPILPAHVSDLLVPLRQLFVRLSIRDRL
PQVEIAVGEKCTVMVLRILEPLSGADEKLLRAFADEHGIVFFLQPKGPASAYRFHPVDGP
DLSYLLPEFGLEMRFSPTEFTQVNPGINQMLIRRAMRLLDPQPGERIADLFCGLGNFTLP
IARSGARVVGVEGLKELTRRAEENAAANGLAANVSFGVANLFECTPKSLGALGHFDKMLI
DPPREGAVEVVKALGEDSPGRIVYVSCNPSTLARDAAILVHQKGYRFSGAGIVNMFPHTS
HVESIALFEKA