Protein Info for Dsui_1979 in Dechlorosoma suillum PS

Annotation: metal-dependent hydrolase, beta-lactamase superfamily I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 255 PF00753: Lactamase_B" amino acids 12 to 147 (136 residues), 57.9 bits, see alignment E=2.1e-19 PF23023: Anti-Pycsar_Apyc1" amino acids 13 to 70 (58 residues), 36.4 bits, see alignment E=7.7e-13 PF12706: Lactamase_B_2" amino acids 22 to 206 (185 residues), 89.2 bits, see alignment E=4.4e-29

Best Hits

KEGG orthology group: None (inferred from 62% identity to app:CAP2UW1_1374)

Predicted SEED Role

"Metal-dependent hydrolases of the beta-lactamase superfamily I" in subsystem Beta-lactamase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QHZ7 at UniProt or InterPro

Protein Sequence (255 amino acids)

>Dsui_1979 metal-dependent hydrolase, beta-lactamase superfamily I (Dechlorosoma suillum PS)
MRFASLGSGSRGNGLLVESGGTRVLLDCGFSLREATYRLQRLGVEPETLAGVLVTHEHSD
HLAGVVRLAARFNLPVWLTPGTATMLPESESAYGQLRRIDSQQSLAVGDLEILPFTVPHD
AREPVQYVFGDGNRRLGVLTDCGSLTSHVLEVLQACDGLFLECNHDPDLLAASAYPPFLK
RRIGGSHGHLANDVAAELLTRLDTSTLQHVVAAHLSEKCNRPELAVAALSGALGCAAEWI
GVADQENGVGWRSFC