Protein Info for Dsui_1973 in Dechlorosoma suillum PS

Annotation: transglutaminase-like enzyme, predicted cysteine protease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 668 signal peptide" amino acids 1 to 35 (35 residues), see Phobius details transmembrane" amino acids 44 to 61 (18 residues), see Phobius details amino acids 68 to 85 (18 residues), see Phobius details amino acids 91 to 109 (19 residues), see Phobius details amino acids 117 to 134 (18 residues), see Phobius details amino acids 140 to 158 (19 residues), see Phobius details amino acids 170 to 191 (22 residues), see Phobius details amino acids 554 to 575 (22 residues), see Phobius details PF11992: TgpA_N" amino acids 25 to 335 (311 residues), 249.5 bits, see alignment E=6.9e-78 PF01841: Transglut_core" amino acids 370 to 477 (108 residues), 85.5 bits, see alignment E=4.6e-28 PF13559: DUF4129" amino acids 586 to 655 (70 residues), 32 bits, see alignment E=1.6e-11

Best Hits

KEGG orthology group: None (inferred from 60% identity to app:CAP2UW1_1368)

Predicted SEED Role

"FIG001454: Transglutaminase-like enzymes, putative cysteine proteases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QHZ1 at UniProt or InterPro

Protein Sequence (668 amino acids)

>Dsui_1973 transglutaminase-like enzyme, predicted cysteine protease (Dechlorosoma suillum PS)
MNWRLPWRRQRRPLPAPLSHSVLPWLLLCALATAGPHTLHQPLWLTAIAGLVLAWRAWLW
LRQLPLPPRWLLSLVSLGSLAAIVVEYRTLLGRDAGVSLLVLFLALKLMELRQRRDGVVV
LMLGYFLLLTHYFHSQSIPTGLWMLLALVLLTATLLRLHGDDRARPLASLRYAGVLTLQA
LPFMLVLYLLFPRISGPLWGLPRDAHAGLSGLSETMAPGSLANLIQNGSIAFRVQFQGET
PPRSQLYWRGPVLDYFADGVWRPRFLPQRKPQVEARGPEVAYVTTLEPHNQRWLLALDSP
TAVPAEAGIGYDLQVLAPAPLTSRSRQAFRSVLDYRHNRQEQPLVLQRALQLPAERNPRT
RELAEQWRRADPRPASLVQRALAHFRQEPFFYTLRAPLLGRDGVDEFLFATRRGFCEHYA
SAFVVLMRAAGVPARVVTGYQGGDINPVDGYLTVRQSDAHAWAEVWLEDQGWRRVDPTAA
ISPARIEAGIAAALPDDEALPLLARVDLDWLVRLRHRWEAANNAWNQWVLGYTPERQRQL
LSRLGLQQPDWRNMSAALAAACGLLLLLLTLWSLGRRPRLAPEERLWQRFCRRSARLAPD
LARAPWEGPLAYGRRLGERLPTLAPQAEAIAGLYATLRYGPPLAPRDRQQLLERLAACIR
ELPSRRPS