Protein Info for Dsui_1971 in Dechlorosoma suillum PS

Annotation: RNA polymerase sigma factor RpoS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 328 TIGR02394: RNA polymerase sigma factor RpoS" amino acids 49 to 327 (279 residues), 434.5 bits, see alignment E=2e-134 PF00140: Sigma70_r1_2" amino acids 51 to 84 (34 residues), 42.1 bits, see alignment 1.4e-14 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 85 to 315 (231 residues), 122.3 bits, see alignment E=1.6e-39 PF04542: Sigma70_r2" amino acids 89 to 159 (71 residues), 78.2 bits, see alignment E=6.5e-26 PF04539: Sigma70_r3" amino acids 169 to 242 (74 residues), 41.5 bits, see alignment E=2.4e-14 PF04545: Sigma70_r4" amino acids 263 to 314 (52 residues), 50.8 bits, see alignment 1.9e-17

Best Hits

Swiss-Prot: 58% identical to RPOS_PSEAE: RNA polymerase sigma factor RpoS (rpoS) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K03087, RNA polymerase nonessential primary-like sigma factor (inferred from 72% identity to dar:Daro_2521)

MetaCyc: 55% identical to RNA polymerase sigma factor RpoS (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"RNA polymerase sigma factor RpoS" in subsystem Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QHY9 at UniProt or InterPro

Protein Sequence (328 amino acids)

>Dsui_1971 RNA polymerase sigma factor RpoS (Dechlorosoma suillum PS)
MRDDADAADFPDGDAEEAFAADEAQDESLAAAATAAEGDDGAPPAYELLNDVTQLYLNEI
GAKPLLTPAEELEWSRRAKAGEFAARQKMIEHNLRLVVNIAKHYLNRGIPLLDLVEEGNL
GLIHALEKFDPERGFRFSTYATWWIRQSIERAIMNQSRTIRLPVHVVKEINVVLRAMRHL
DGARGLTPSRETRVEEVAHLLGKPVDDIRHILHLNEHVASLDTPLDIDPNHTVGDSVADD
SAGADPVGVLQENELNDLVLQWVEQLPEKQRQVVERRYGLKGAEIATLEAIAADLGLTRE
RVRQIQGEALSQLRRIIKRGGVDRDSIL