Protein Info for Dsui_1952 in Dechlorosoma suillum PS
Annotation: D-heptose-7- phosphate 1-kinase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 58% identical to HEPPK_BORBR: D-beta-D-heptose 7-phosphate kinase (rfaE) from Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
KEGG orthology group: None (inferred from 74% identity to app:CAP2UW1_2895)Predicted SEED Role
"ADP-heptose synthase (EC 2.7.-.-) / D-glycero-beta-D-manno-heptose 7-phosphate kinase" in subsystem LOS core oligosaccharide biosynthesis (EC 2.7.-.-)
MetaCyc Pathways
- ADP-L-glycero-β-D-manno-heptose biosynthesis (4/5 steps found)
KEGG Metabolic Maps
Isozymes
Compare fitness of predicted isozymes for: 2.7.-.-
Use Curated BLAST to search for 2.7.-.-
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See G8QHX2 at UniProt or InterPro
Protein Sequence (315 amino acids)
>Dsui_1952 D-heptose-7- phosphate 1-kinase (Dechlorosoma suillum PS) MHQLPDFSAARILVVGDVMLDRYWFGDVSRISPEAPVPVVKVERSEERPGGAANVARNCA SLGARVGLLSVVGNDEAGRILQRQMEEGGIAASLLPDGAIDTTVKLRVIGRQQQLLRIDF ETTPSHEVLQAKLAEFEQRLAGVDVVILSDYGKGGLAHIGDMIRLARAAGKKVLVDPKGE DYSKYRGATVITPNRSELRQVVGRWSDEAQLAAKAQQLRSELELEALLVTRSEEGMSLYR DGEALHQPARAQEVFDVSGAGDTVIATLAAMMALGAPWGDAIHLANLAGGVVVGKLGTAT VSREELSAALAADAN