Protein Info for Dsui_1947 in Dechlorosoma suillum PS

Annotation: nucleotide sugar dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 441 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF03721: UDPG_MGDP_dh_N" amino acids 1 to 187 (187 residues), 220 bits, see alignment E=3e-69 TIGR03026: nucleotide sugar dehydrogenase" amino acids 1 to 421 (421 residues), 451.9 bits, see alignment E=9.2e-140 PF00984: UDPG_MGDP_dh" amino acids 204 to 297 (94 residues), 126.4 bits, see alignment E=5.8e-41 PF03720: UDPG_MGDP_dh_C" amino acids 321 to 425 (105 residues), 108.8 bits, see alignment E=2.6e-35

Best Hits

Swiss-Prot: 48% identical to TUAD_BACSU: UDP-glucose 6-dehydrogenase TuaD (tuaD) from Bacillus subtilis (strain 168)

KEGG orthology group: K00012, UDPglucose 6-dehydrogenase [EC: 1.1.1.22] (inferred from 83% identity to dar:Daro_1284)

MetaCyc: 48% identical to UDP-glucose 6-dehydrogenase (Bacillus subtilis subtilis 168)
UDP-glucose 6-dehydrogenase. [EC: 1.1.1.22]

Predicted SEED Role

"UDP-glucose dehydrogenase (EC 1.1.1.22)" in subsystem Lipid A-Ara4N pathway ( Polymyxin resistance ) or Teichuronic acid biosynthesis (EC 1.1.1.22)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QHW7 at UniProt or InterPro

Protein Sequence (441 amino acids)

>Dsui_1947 nucleotide sugar dehydrogenase (Dechlorosoma suillum PS)
MKVTVVGTGYVGLVSGTCLAEVGNDVLCLDVDPEKIRILNEGGIPIFEPGLLDMVKRNVA
AGRLRFTTDVEQAVAHGTIQFIAVGTPPDEDGSADLQYVLAAARNIGRHMGDYKVVVDKS
TVPVGTGDKVRAAIADELKARGADIAYSVVSNPEFLKEGAAVEDFMRPDRIVVGAEDERA
IELMRALYAPFQRNHERLIVMDVRSAELTKYAANAMLATRISFMNELANLAEKLGADIEQ
VRQGIGSDPRIGYHFLYPGCGYGGSCFPKDVQALQRTARLDAGMEMKVLNAVEDANDAQK
HVLTAKTVKRFGNDLSGRKFAVWGLAFKPNTDDMREAPSRYLLADLFAAGATVVAYDPVA
MHEARRIFGDEPRLSYAESPMAALDGADALLIVTEWKEFRSPDFEAIKAKLKQPVIFDGR
NLYEPKQVRQFGIDYQAIGRQ