Protein Info for Dsui_1943 in Dechlorosoma suillum PS

Annotation: ribosomal protein S1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 568 TIGR00717: ribosomal protein bS1" amino acids 10 to 527 (518 residues), 681.7 bits, see alignment E=3e-209 PF00575: S1" amino acids 26 to 92 (67 residues), 22.6 bits, see alignment E=2.8e-08 amino acids 110 to 178 (69 residues), 41.4 bits, see alignment E=4e-14 amino acids 196 to 267 (72 residues), 80.4 bits, see alignment E=2.6e-26 amino acids 283 to 354 (72 residues), 75.1 bits, see alignment E=1.2e-24 amino acids 368 to 441 (74 residues), 65.8 bits, see alignment E=9e-22 amino acids 455 to 527 (73 residues), 52.8 bits, see alignment E=1e-17 PF23459: S1_RRP5" amino acids 196 to 266 (71 residues), 28.2 bits, see alignment E=5.8e-10 amino acids 460 to 525 (66 residues), 30.3 bits, see alignment E=1.3e-10

Best Hits

Swiss-Prot: 73% identical to RS1_NEIMB: 30S ribosomal protein S1 (rpsA) from Neisseria meningitidis serogroup B (strain MC58)

KEGG orthology group: K02945, small subunit ribosomal protein S1 (inferred from 83% identity to tmz:Tmz1t_3035)

MetaCyc: 64% identical to 30S ribosomal subunit protein S1 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"SSU ribosomal protein S1p" in subsystem Ribosome SSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QHW3 at UniProt or InterPro

Protein Sequence (568 amino acids)

>Dsui_1943 ribosomal protein S1 (Dechlorosoma suillum PS)
MTTASPISQESFAALFEESLARQEMRSGEVITAEVVRVDQNFVVVNAGLKSESYIPVEEF
LSDAGEVEAKIGDFVQVAIEQLEDGFGETRLSRDKAKRIAAWNDLEKALNEGTLVTGVIT
GKVKGGLTVMTNSVRSFLPGSLVDIRPVKDTTPYEGKTMEFKVIKLDRKRNNVVVSRRAV
LEETMGEEREKLLSTLQEGATVKGIVKNITDYGAFVDLGGIDGLLHITDLAWRRVRHPSE
VLAVGDEVTAKVLKFDTEKNRVSLGLKQLGEDPWVGISRRYPSGTRLFGKVTNLTDYGAF
VEIEQGIEGLVHVSEMDWTNKNVHPTKVVQLGDEVEVMILEIDEDRRRISLGMKQCLANP
WEEFAQNHKKGDKVSGQIKSITDFGVFIGLPGNIDGLVHLSDLSWSTTGEEAIRNFKKGD
EVQAVVLAIDTDKERISLGIKQLEGDPYTNYIATHEKNTIVRAVVKSVDAKGAVLQLEGD
VEGYLRASEYSRDRVEDLSQLVKVGDELEAMIINVDRKSRNVNLSIKAKDQAEQHEAMQK
FASESSAASGTTNLGALLKAKLNGSNQG