Protein Info for Dsui_1942 in Dechlorosoma suillum PS

Annotation: cytidylate kinase/3-phosphoshikimate 1-carboxyvinyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00275: EPSP_synthase
  • amino acids 14 to 422 (409 residues), 423.7 bits, E=7e-131
• TIGR01356: 3-phosphoshikimate 1-carboxyvinyltransferase
  • amino acids 14 to 426 (413 residues), 464.2 bits, E=3.8e-143
• TIGR00017: cytidylate kinase
  • amino acids 430 to 638 (209 residues), 230.5 bits, E=1.9e-72
• PF02224: Cytidylate_kin
  • amino acids 432 to 638 (207 residues), 234.3 bits, E=1.3e-73

Best Hits

KEGG orthology group: K00800, 3-phosphoshikimate 1-carboxyvinyltransferase [EC: 2.5.1.19] (inferred from 80% identity to dar:Daro_1279)

Predicted SEED Role

No annotation

MetaCyc Pathways

• superpathway of chorismate metabolism (48/59 steps found)
• superpathway of aromatic amino acid biosynthesis (18/18 steps found)
• superpathway of L-tryptophan biosynthesis (13/13 steps found)
• superpathway of L-phenylalanine biosynthesis (10/10 steps found)
• superpathway of L-tyrosine biosynthesis (10/10 steps found)
• chorismate biosynthesis I (7/7 steps found)
• chorismate biosynthesis from 3-dehydroquinate (5/5 steps found)
• chorismate biosynthesis II (archaea) (8/12 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Phenylalanine, tyrosine and tryptophan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.19

Sequence Analysis Tools

See G8QHW2 at UniProt or InterPro

Protein Sequence (644 amino acids)

>Dsui_1942 cytidylate kinase/3-phosphoshikimate 1-carboxyvinyltransferase (Dechlorosoma suillum PS)
MEFLDLAPFVSAGGTVRLPGSKSISNRVLLLAALAEGVTEVRDLLHSDDTERMLEALQQL
GVGVESLGGEAYRITGVGGPFPVKEAELFLGNAGTAFRPLTAALALAGGHYVLKGVARMH
ERPIGDLVDGLRQLGAEVRYLGNDGFPPLEIFPASIRAGGVLQVRGDVSSQFLTALLMAL
PLTGVETRVEVVGELISKPYIEITLATMARFGVEVQREGWQAFVVPAGVRYVSPGTVYVE
GDASSASYFLAAGAIGGGPLRVEGVGKDSIQGDVRFAEALALMGARIEMGPNWIEARAPA
SGKLQAIDLDCNHIPDAAMTLATAALFAEGTTVLRNIASWRVKETDRIAAMATELQKLGA
VVEEGPDYLKVTPVPALKPAAIDTYDDHRMAMCFSLAAFATPLRINDPKCVAKTFPDYFE
RLATVTRSVPVIAIDGPSASGKGTVAARVAAALGFGYLDSGALYRLTALAAQRAGVDWDD
EAGVAAVAAGLEVVFGEGSIRLAGEEVEGAIRTEEISQGASKVAALPAVRAALLFRQRVF
RCGAGLVGDGRDIGSVVFPDSRLKVFLTASAEVRAERRYKQLIGKGFPANMQAILLDLRE
RDRRDSERSVAPLQQNEDAVLLDTSGLTIDQAVDQVLDWYGSAS