Protein Info for Dsui_1942 in Dechlorosoma suillum PS

Annotation: cytidylate kinase/3-phosphoshikimate 1-carboxyvinyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 644 PF00275: EPSP_synthase" amino acids 14 to 422 (409 residues), 423.7 bits, see alignment E=7e-131 TIGR01356: 3-phosphoshikimate 1-carboxyvinyltransferase" amino acids 14 to 426 (413 residues), 464.2 bits, see alignment E=3.8e-143 TIGR00017: cytidylate kinase" amino acids 430 to 638 (209 residues), 230.5 bits, see alignment E=1.9e-72 PF02224: Cytidylate_kin" amino acids 432 to 638 (207 residues), 234.3 bits, see alignment E=1.3e-73

Best Hits

KEGG orthology group: K00800, 3-phosphoshikimate 1-carboxyvinyltransferase [EC: 2.5.1.19] (inferred from 80% identity to dar:Daro_1279)

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QHW2 at UniProt or InterPro

Protein Sequence (644 amino acids)

>Dsui_1942 cytidylate kinase/3-phosphoshikimate 1-carboxyvinyltransferase (Dechlorosoma suillum PS)
MEFLDLAPFVSAGGTVRLPGSKSISNRVLLLAALAEGVTEVRDLLHSDDTERMLEALQQL
GVGVESLGGEAYRITGVGGPFPVKEAELFLGNAGTAFRPLTAALALAGGHYVLKGVARMH
ERPIGDLVDGLRQLGAEVRYLGNDGFPPLEIFPASIRAGGVLQVRGDVSSQFLTALLMAL
PLTGVETRVEVVGELISKPYIEITLATMARFGVEVQREGWQAFVVPAGVRYVSPGTVYVE
GDASSASYFLAAGAIGGGPLRVEGVGKDSIQGDVRFAEALALMGARIEMGPNWIEARAPA
SGKLQAIDLDCNHIPDAAMTLATAALFAEGTTVLRNIASWRVKETDRIAAMATELQKLGA
VVEEGPDYLKVTPVPALKPAAIDTYDDHRMAMCFSLAAFATPLRINDPKCVAKTFPDYFE
RLATVTRSVPVIAIDGPSASGKGTVAARVAAALGFGYLDSGALYRLTALAAQRAGVDWDD
EAGVAAVAAGLEVVFGEGSIRLAGEEVEGAIRTEEISQGASKVAALPAVRAALLFRQRVF
RCGAGLVGDGRDIGSVVFPDSRLKVFLTASAEVRAERRYKQLIGKGFPANMQAILLDLRE
RDRRDSERSVAPLQQNEDAVLLDTSGLTIDQAVDQVLDWYGSAS