Protein Info for Dsui_1934 in Dechlorosoma suillum PS

Annotation: ubiquinone biosynthesis O-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01983: 3-demethylubiquinone-9 3-O-methyltransferase
  • amino acids 8 to 225 (218 residues), 282.1 bits, E=1.4e-88
• PF05724: TPMT
  • amino acids 17 to 83 (67 residues), 28.4 bits, E=7.7e-10
• PF06325: PrmA
  • amino acids 35 to 150 (116 residues), 28.7 bits, E=5.7e-10
• PF01209: Ubie_methyltran
  • amino acids 41 to 173 (133 residues), 43.2 bits, E=1.9e-14
• PF08003: Methyltransf_9
  • amino acids 45 to 152 (108 residues), 25.7 bits, E=3.4e-09
• PF13489: Methyltransf_23
  • amino acids 46 to 201 (156 residues), 88.3 bits, E=2.8e-28
• PF02353: CMAS
  • amino acids 47 to 157 (111 residues), 39.8 bits, E=2.1e-13
• PF05175: MTS
  • amino acids 47 to 118 (72 residues), 28.9 bits, E=5.1e-10
• PF13847: Methyltransf_31
  • amino acids 48 to 152 (105 residues), 57.7 bits, E=6.9e-19
• PF13649: Methyltransf_25
  • amino acids 51 to 144 (94 residues), 76.1 bits, E=1.7e-24
• PF08242: Methyltransf_12
  • amino acids 52 to 145 (94 residues), 69.3 bits, E=2.4e-22
• PF08241: Methyltransf_11
  • amino acids 52 to 147 (96 residues), 86.3 bits, E=1.1e-27

Best Hits

Swiss-Prot: 78% identical to UBIG_DECAR: Ubiquinone biosynthesis O-methyltransferase (ubiG) from Dechloromonas aromatica (strain RCB)

KEGG orthology group: K00568, 3-demethylubiquinone-9 3-methyltransferase [EC: 2.1.1.- 2.1.1.64] (inferred from 78% identity to dar:Daro_1227)

MetaCyc: 59% identical to bifunctional 3-demethylubiquinol 3-O-methyltransferase/polyprenyldihydroxybenzoate methyltransferase (Xanthomonas campestris pv. campestris)
3-demethylubiquinone-9 3-O-methyltransferase. [EC: 2.1.1.64]; Hexaprenyldihydroxybenzoate methyltransferase. [EC: 2.1.1.64, 2.1.1.114]

Predicted SEED Role

"3-demethylubiquinone-9 3-methyltransferase (EC 2.1.1.64)" in subsystem Ubiquinone Biosynthesis (EC 2.1.1.64)

MetaCyc Pathways

• superpathway of chorismate metabolism (48/59 steps found)
• superpathway of ubiquinol-8 biosynthesis (early decarboxylation) (10/12 steps found)
• ubiquinol-8 biosynthesis (early decarboxylation) (6/8 steps found)
• ubiquinol-8 biosynthesis (late decarboxylation) (6/9 steps found)
• ubiquinol-6 biosynthesis (late decarboxylation) (3/8 steps found)
• ubiquinol-6 biosynthesis from 4-aminobenzoate (yeast) (3/9 steps found)
• ubiquinol-10 biosynthesis (early decarboxylation) (2/8 steps found)
• ubiquinol-7 biosynthesis (early decarboxylation) (2/8 steps found)
• ubiquinol-7 biosynthesis (late decarboxylation) (2/8 steps found)
• ubiquinol-9 biosynthesis (early decarboxylation) (2/8 steps found)
• ubiquinol-9 biosynthesis (late decarboxylation) (2/8 steps found)
• superpathway of ubiquinol-6 biosynthesis (late decarboxylation) (4/11 steps found)
• ubiquinol-10 biosynthesis (late decarboxylation) (2/9 steps found)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-, 2.1.1.64

Use Curated BLAST to search for 2.1.1.- or 2.1.1.114 or 2.1.1.64

Sequence Analysis Tools

See G8QHV4 at UniProt or InterPro

Protein Sequence (232 amino acids)

>Dsui_1934 ubiquinone biosynthesis O-methyltransferase (Dechlorosoma suillum PS)
MINADPNELQKFSDLAHRWWDPKSEFKPLHDINPLRLDWIDANVGLAGKKVLDVGCGGGL
LSEGMAERGAQVTGIDLSEKALGVARLHLLESGRSVDYRHISAESLAAEMPGSFDVVTCL
EMLEHVPDPASTVAACARLVKPGGQVFLSTLNRNPKSYLLAVIGAEYLLQMLPKGTHDYA
KFIKPSELARHCKAADLEVAEIIGMTYNPFTQRYSLGRDTSVNYLLRTVRNA