Protein Info for Dsui_1931 in Dechlorosoma suillum PS

Annotation: transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 168 PF13404: HTH_AsnC-type" amino acids 23 to 65 (43 residues), 37.1 bits, see alignment E=3.5e-13 PF22451: NirdL-like_HTH" amino acids 26 to 71 (46 residues), 65.5 bits, see alignment E=3.9e-22 PF17805: AsnC_trans_reg2" amino acids 88 to 152 (65 residues), 51 bits, see alignment E=2e-17

Best Hits

Swiss-Prot: 56% identical to NIRG_PSEST: Protein NirG (nirG) from Pseudomonas stutzeri

KEGG orthology group: None (inferred from 67% identity to tmz:Tmz1t_2611)

MetaCyc: 49% identical to siroheme decarboxylase NirG subunit (Paracoccus pantotrophus)
RXN-15805 [EC: 4.1.1.111]

Predicted SEED Role

"Heme d1 biosynthesis protein NirG" in subsystem Dissimilatory nitrite reductase or Heme biosynthesis orphans

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.111

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QHV1 at UniProt or InterPro

Protein Sequence (168 amino acids)

>Dsui_1931 transcriptional regulator (Dechlorosoma suillum PS)
MADTAEKTKPSRRAALAPAREPDELDRRIINALQGDFPLSPEPYAEAATKLGISEAELLA
RLQSLLDDRILTRFGPMFQIERLGGAFCLAAMAVPDAEFERVAEQVNALPQVAHNYAREH
AFNMWFVLATETPEGIDAAVQAIEAATGYPVYPFPKEKEYFVEMKLQA