Protein Info for Dsui_1929 in Dechlorosoma suillum PS

Annotation: Prokaryotic membrane lipoprotein lipid attachment site/Cytochrome D1 heme domain protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 397 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF02239: Cytochrom_D1" amino acids 33 to 391 (359 residues), 367.6 bits, see alignment E=2.6e-114

Best Hits

Swiss-Prot: 60% identical to NIRF_PSEAE: Protein NirF (nirF) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 74% identity to eba:ebA883)

MetaCyc: 55% identical to heme d1 dehydrogenase (Paracoccus pantotrophus)
1.1.1.-

Predicted SEED Role

"Heme d1 biosynthesis protein NirF" in subsystem Dissimilatory nitrite reductase

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QHU9 at UniProt or InterPro

Protein Sequence (397 amino acids)

>Dsui_1929 Prokaryotic membrane lipoprotein lipid attachment site/Cytochrome D1 heme domain protein (Dechlorosoma suillum PS)
MTPATPVVSRRFLLPVLLLSLLTGCASAPAPRGSGDLGVVIERSIGQVQVVNTTSKTALA
KVPGLGDLSHASVVFSRDQRYAYVFGRDGGLTKVDILNASIAKRIVQAGNAIGGAISQDG
KLVVAQNYEPGGIKAFDAETLELVADIPSVDMNGVRSKVVGLADLSGNRFAFSLFEAGEI
WVADLSNVKAPKVQKYSAGKQPYDALVTPDGRYYIAGLFGEDGLAMLDTWQPEQGVQKIL
AGYGKGEQPLPVYKMPHLRGWSVAGGKAYLPAIGRHEVLVVDTKTWKETARIPVKSQPVF
VMARPDGREIWVNFAFPDNGWVQVIDTLEGKVTHTLQPGKAILHMEFAPRGEAVWLSARD
DNKVTVFDTRTKAPVAELKAESPSGIFFTSRAARTGF