Protein Info for Dsui_1926 in Dechlorosoma suillum PS

Annotation: acetolactate synthase, small (regulatory) subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 105 PF01842: ACT" amino acids 18 to 82 (65 residues), 37.5 bits, see alignment E=2.4e-13 PF22629: ACT_AHAS_ss" amino acids 20 to 84 (65 residues), 97.2 bits, see alignment E=7.8e-32 PF13710: ACT_5" amino acids 29 to 87 (59 residues), 34.3 bits, see alignment E=2.4e-12

Best Hits

Swiss-Prot: 59% identical to ILVN_ECO57: Acetolactate synthase isozyme 1 small subunit (ilvN) from Escherichia coli O157:H7

KEGG orthology group: K01653, acetolactate synthase I/III small subunit [EC: 2.2.1.6] (inferred from 78% identity to app:CAP2UW1_0275)

MetaCyc: 59% identical to acetohydroxy acid synthase I subunit IlvN (Escherichia coli K-12 substr. MG1655)
Acetolactate synthase. [EC: 2.2.1.6]; 2.2.1.6 [EC: 2.2.1.6]

Predicted SEED Role

"Acetolactate synthase small subunit (EC 2.2.1.6)" in subsystem Acetoin, butanediol metabolism or Branched-Chain Amino Acid Biosynthesis (EC 2.2.1.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.2.1.6

Use Curated BLAST to search for 2.2.1.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QHU6 at UniProt or InterPro

Protein Sequence (105 amino acids)

>Dsui_1926 acetolactate synthase, small (regulatory) subunit (Dechlorosoma suillum PS)
MNAVSKKENAALARPQRTVLELEVNNHAGVMSHVVGLFSRRAYNVEGILCLPVGDGSISR
IWLLVLEDRRLEQMVKQVEKLEDVRTVRRHGADHAVFERLEEFFR