Protein Info for Dsui_1921 in Dechlorosoma suillum PS

Annotation: biopolymer transport protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 202 transmembrane" amino acids 18 to 42 (25 residues), see Phobius details amino acids 100 to 124 (25 residues), see Phobius details amino acids 136 to 157 (22 residues), see Phobius details PF01618: MotA_ExbB" amino acids 72 to 171 (100 residues), 48.1 bits, see alignment E=4.8e-17

Best Hits

Predicted SEED Role

"hypothetical transporter PduT for various metalloporphyrins"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QHF0 at UniProt or InterPro

Protein Sequence (202 amino acids)

>Dsui_1921 biopolymer transport protein (Dechlorosoma suillum PS)
MEIVTLIEQLLYQVSTALYLPVIGGCALLVAYVPLQLGITLFDAWQRRRGHLPEVESFKL
RLGQLRHRLKGYPRRLEIEVERLLQAEELELSRRLDRIRFVIKVGPALGLMGTLIPMGIS
LAALAEGNIPKMAGSMVTAFTATVAGLGAGVLAYLLALSRERWVRADVREMAHAAELALA
ESGQPLPHHLQTEADDAVAAAA