Protein Info for Dsui_1908 in Dechlorosoma suillum PS

Annotation: putative Fe-S-cluster redox enzyme

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 443 PF04055: Radical_SAM" amino acids 103 to 261 (159 residues), 49.8 bits, see alignment E=2.3e-17

Best Hits

Swiss-Prot: 71% identical to Y2870_AROAE: Probable RNA methyltransferase AZOSEA28700 (AZOSEA28700) from Aromatoleum aromaticum (strain EbN1)

KEGG orthology group: K06941, ribosomal RNA large subunit methyltransferase N [EC: 2.1.1.-] (inferred from 71% identity to eba:ebA5068)

Predicted SEED Role

"Ribosomal RNA large subunit methyltransferase N (EC 2.1.1.-)" in subsystem Conserved gene cluster associated with Met-tRNA formyltransferase (EC 2.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QHD8 at UniProt or InterPro

Protein Sequence (443 amino acids)

>Dsui_1908 putative Fe-S-cluster redox enzyme (Dechlorosoma suillum PS)
MQLEHIRQRLAALGAKTCHEDRVLRAWLQAQPLDAGARRRQAQDYLPKAIREELPALAAD
LEALARVHSEHPGADGSARLLVRLGDGQAVESVLLPRDGVCVSTQVGCAVGCTFCMTGRD
GLLRQLSSGEIVAQVVLARARRPVKKVVFMGMGEPAHNLDNVLAAIDLLGSAGGIGHKNL
VFSTVGDRRVFERLPQQAVKPALALSLHTSRAELRAQLLPKAPRLTPEELVELGEEYARS
TGYPIQYQWTLLDGVNDSEAEMDGIVRLLSGKYAIMNLIPFNAVGGEDEAGEGAFRRPVW
ERARYLARYLHQRRILTKLRNSAGQDIDGGCGQLRARSLAEDPSSPQAAAAPQAISGPAP
RRRQPRPRSRRRRLPHTHWSHPCCANSCSPSSSSAAWPTARRRRKPRWKWWPPNSASLKR
RRATWCSLPPTWCPTCWASATAG