Protein Info for Dsui_1881 in Dechlorosoma suillum PS

Annotation: methyl-accepting chemotaxis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 678 signal peptide" amino acids 1 to 46 (46 residues), see Phobius details transmembrane" amino acids 325 to 347 (23 residues), see Phobius details PF17201: Cache_3-Cache_2" amino acids 40 to 324 (285 residues), 121.2 bits, see alignment E=8.4e-39 PF00672: HAMP" amino acids 349 to 397 (49 residues), 23.5 bits, see alignment 8.4e-09 PF00015: MCPsignal" amino acids 461 to 644 (184 residues), 156.8 bits, see alignment E=7.5e-50

Best Hits

KEGG orthology group: None (inferred from 49% identity to dar:Daro_0837)

Predicted SEED Role

"Methyl-accepting chemotaxis protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QHB1 at UniProt or InterPro

Protein Sequence (678 amino acids)

>Dsui_1881 methyl-accepting chemotaxis protein (Dechlorosoma suillum PS)
MLDLYRRLPIARQIIIVAASLLLLIFTAMTVMATSMASRSAVALAESDLKEQMSILQDTL
DSVFDSVLARGERQMNFFRRQLPGDFNLGSGMVRTGNVDLPVIRAGGEVLNANRKMLLAF
QELTGEDAAVLAVHEGKLYRAATLLKKDGVYQDGTEINAGDPVADAILQGKDYGGLAIRN
GTYYFSTVKALKTAEGKVYGGISVRIKLDSELRDVRALFGKVKVADTGYVYIARQTKDDK
TLVEFVAHPTLAGKTLEGMDGETRDSIAKAVAGPDGLLSYEMKDANGKMRKKLGVAGTSE
RWGWRLVGASWEDEFLAESMKLRNFLVISSIVAALLSCAVIFFLVNVRLKPLSEFMVQMD
RLGAGDLTISVRDADGNSGNEVQRLGHSLNVTAANVRSLVGEISAAAGRVNAAASEVENA
SHQAMDAAEQQSQSASGMAASVEQMSVSISHVAASAGDAAQVGEEAAESTHRGRSIVQKT
VEEMERIAGEIGRSAEVIHSLGERSQQISGIVGVIKEIADQTNLLALNAAIEAARAGEQG
RGFAVVADEVRKLAERTSSSTQEIADTIAAITGETQSAVAGMQVVSRQVEAGVEMAREAG
EALQVIDANTEKSVSTVRDIADSTREQSVVSQEIARLVEQIAQMAEEGSATSTQNTEYAR
NLQTLAQELQTALQRFKV