Protein Info for Dsui_1851 in Dechlorosoma suillum PS

Annotation: signal transduction histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 474 transmembrane" amino acids 6 to 29 (24 residues), see Phobius details amino acids 173 to 197 (25 residues), see Phobius details PF18225: AbfS_sensor" amino acids 58 to 105 (48 residues), 39.1 bits, see alignment 1.2e-13 PF00672: HAMP" amino acids 191 to 246 (56 residues), 50 bits, see alignment 6e-17 PF00512: HisKA" amino acids 251 to 313 (63 residues), 51.7 bits, see alignment E=1.5e-17 PF02518: HATPase_c" amino acids 363 to 470 (108 residues), 94.5 bits, see alignment E=1.1e-30

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QGU1 at UniProt or InterPro

Protein Sequence (474 amino acids)

>Dsui_1851 signal transduction histidine kinase (Dechlorosoma suillum PS)
MSRLFWKFFVTFWLTLLTANIIVGGLIWLHRSAEFEQQQGSRPGQPPTFMLGVAASLLQH
DGEESLKQLLRDWQQSHPEPIYAVDAQGMDLLGRPVPEGALDKARQGIRDGQPGPWRLAQ
RSMSSPILLFMPGGPFRPEDLFGPGGGPPEAHLLGEPGGPPPPHRNMGPKPPLPWLLIAT
GLVASLAFSALLAWTIVGPIRRLRQGFRAVAAGRLETRLGQEFAKRKDEIGELGQEFDAM
AQQLEALMATQRRLFHDVSHELRSPLARLQAAVGLVHQDPSRIAGALERIERETQRLDEM
VDELLTLARLDSGTSGPLEDEIDLPALLHSIVDDAAFEAEAQGRHVDFQDRCGEAPAFIR
GRPELLGRALENVIRNGIKYTAPGTRVTVEAERDGDSLRVRVADAGPGVPEAELDAIFVP
FFRGADREQQRGYGLGLAIARRAIQAHGGSIRASNRPDGGLQVEIHLPLQPIPA