Protein Info for Dsui_1845 in Dechlorosoma suillum PS

Annotation: phosphate/sulfate permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 347 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 43 to 68 (26 residues), see Phobius details amino acids 80 to 101 (22 residues), see Phobius details amino acids 111 to 134 (24 residues), see Phobius details amino acids 146 to 167 (22 residues), see Phobius details amino acids 210 to 253 (44 residues), see Phobius details amino acids 272 to 301 (30 residues), see Phobius details amino acids 319 to 344 (26 residues), see Phobius details PF01384: PHO4" amino acids 22 to 333 (312 residues), 293.1 bits, see alignment E=1.4e-91

Best Hits

KEGG orthology group: K03306, inorganic phosphate transporter, PiT family (inferred from 80% identity to dar:Daro_0679)

Predicted SEED Role

"Probable low-affinity inorganic phosphate transporter" in subsystem Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QGT5 at UniProt or InterPro

Protein Sequence (347 amino acids)

>Dsui_1845 phosphate/sulfate permease (Dechlorosoma suillum PS)
MDLLFWLAVATVVVVLCFDYTNGFHDAANIVATVIASRAMTPAQAVIIVGIFEFLGPLLG
GTAVANTIGSFVRLDGIDPASALTILLCGLLGAIVWNLLTWWRGIPSSSSHALVGGLVGV
VVVSAGADQVVWGFRELFHNGHVSGVMKVLLALLLSPLIGFWCGYAVQRLMHALLLAAKP
AANRGLKGAQFLTAAGLAFSHGANDAQKSMGILTLVLLLGGFIPTFTVPFWVILACASAI
TLGILSGGWRIVRTLGFAIYRVRPLHALNSQLTSAAVIFAASLAGAPVSTTHVVATSIMG
IGASERPRAVRWNKAKEIATTWVITIPGAALAAILIYAVLRLFLGPA