Protein Info for Dsui_1835 in Dechlorosoma suillum PS

Annotation: glycosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 398 PF13439: Glyco_transf_4" amino acids 14 to 183 (170 residues), 114.7 bits, see alignment E=1.4e-36 PF13579: Glyco_trans_4_4" amino acids 15 to 179 (165 residues), 68.6 bits, see alignment E=2.5e-22 PF00534: Glycos_transf_1" amino acids 193 to 358 (166 residues), 135.8 bits, see alignment E=3.5e-43 PF20706: GT4-conflict" amino acids 200 to 364 (165 residues), 47.7 bits, see alignment E=3.6e-16 PF13692: Glyco_trans_1_4" amino acids 204 to 345 (142 residues), 115 bits, see alignment E=1.1e-36 PF13524: Glyco_trans_1_2" amino acids 231 to 376 (146 residues), 40.2 bits, see alignment E=1e-13

Best Hits

KEGG orthology group: None (inferred from 58% identity to eba:ebA5576)

Predicted SEED Role

"Glycosyl transferase, group 1"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QGS5 at UniProt or InterPro

Protein Sequence (398 amino acids)

>Dsui_1835 glycosyltransferase (Dechlorosoma suillum PS)
MHVLMLSDVYFPRINGVSTSIETFRREFEAAGDRVTLMVPDYPGAQAEPGIIRIASHRLP
LDPEDRRMELRTILAHEEQLRGMDIDLIHIQTPFIAHYAGTALAKRLGVPCVETYHTLFE
EYFHHYIPFLPKGMLRGLTRRFSRRQCNALDGVIVPSTAMAERLQSYGVTTPLRVVPTGI
PLQQFGQGDGAAFRQRLGLAPETPVALFVGRVAGEKNIDFLLQAHRLALLRLPELHLVVA
GEGPALAGLRRLAEALGTSDKVRFVGYLHRRDELPACYAAADAFVFASRTETQGLVLLEA
MAEGVPVVALSIMGTRDILMPARGAVSPPDDPAEFAEALANLLQNPEQRQRLAREAREYV
LEWSAPACAGRLRQALAELLQSRMNTGPLTPCTSSPVD