Protein Info for Dsui_1815 in Dechlorosoma suillum PS

Annotation: glutathione S-transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 198 PF02798: GST_N" amino acids 2 to 72 (71 residues), 58.1 bits, see alignment E=2.7e-19 PF13417: GST_N_3" amino acids 11 to 77 (67 residues), 47.3 bits, see alignment E=6.3e-16 PF22441: CLIC-like_N" amino acids 11 to 74 (64 residues), 28.3 bits, see alignment E=5e-10 PF13409: GST_N_2" amino acids 11 to 73 (63 residues), 51.3 bits, see alignment E=4.4e-17 PF00043: GST_C" amino acids 100 to 182 (83 residues), 39.7 bits, see alignment E=1.4e-13 PF13410: GST_C_2" amino acids 115 to 173 (59 residues), 31.7 bits, see alignment E=4.2e-11

Best Hits

Swiss-Prot: 43% identical to SSPA_ECOL6: Stringent starvation protein A (sspA) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K03599, RNA polymerase-associated protein (inferred from 88% identity to app:CAP2UW1_0317)

Predicted SEED Role

"Stringent starvation protein A"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QGQ5 at UniProt or InterPro

Protein Sequence (198 amino acids)

>Dsui_1815 glutathione S-transferase (Dechlorosoma suillum PS)
MMNLYSGTTDPFSHRCRIVLFEKGMDFQVIDVDLFNKPEDIAVINPYNRVPVLVERELIL
YEPNIINEYIDERFPHPQLMPADPIMRARARQLLSTMEREIFAYIEPLEKNAKTADKART
EIRNRLTELAPMFAKQKFMLGDEFSMLDVAIAPLLWRLDHYGIDLPKTAAPLMKYAERIF
SRQGFIDALTPSEKVMRK