Protein Info for Dsui_1810 in Dechlorosoma suillum PS

Annotation: DNA-binding protein, YbaB/EbfC family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 107 TIGR00103: DNA-binding protein, YbaB/EbfC family" amino acids 3 to 103 (101 residues), 111.8 bits, see alignment E=7.9e-37 PF02575: YbaB_DNA_bd" amino acids 10 to 98 (89 residues), 114.6 bits, see alignment E=9.8e-38

Best Hits

Swiss-Prot: 86% identical to Y807_DECAR: Nucleoid-associated protein Daro_0807 (Daro_0807) from Dechloromonas aromatica (strain RCB)

KEGG orthology group: K09747, hypothetical protein (inferred from 86% identity to dar:Daro_0807)

Predicted SEED Role

"FIG000557: hypothetical protein co-occurring with RecR"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QGQ0 at UniProt or InterPro

Protein Sequence (107 amino acids)

>Dsui_1810 DNA-binding protein, YbaB/EbfC family (Dechlorosoma suillum PS)
MMKGGIAGLMKQAQQMQENMKKAQEELGRVEVEGQAGAGMVKVLMTCSHDVRRVTIDPSV
MDDKEMLEDLIAAAVNDAVRRGEELSKERMSGFTAGLNLPPGFKLPF