Protein Info for Dsui_1789 in Dechlorosoma suillum PS

Annotation: diguanylate cyclase (GGDEF) domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 592 PF00990: GGDEF" amino acids 433 to 588 (156 residues), 147.6 bits, see alignment E=1.4e-47 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 433 to 591 (159 residues), 156.1 bits, see alignment E=3.3e-50

Best Hits

KEGG orthology group: K13590, diguanylate cyclase (inferred from 61% identity to app:CAP2UW1_0208)

Predicted SEED Role

"Putative diheme cytochrome c-553" in subsystem Soluble cytochromes and functionally related electron carriers

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QGN8 at UniProt or InterPro

Protein Sequence (592 amino acids)

>Dsui_1789 diguanylate cyclase (GGDEF) domain-containing protein (Dechlorosoma suillum PS)
MAALSNPSEIAREVLRQLAVRRIPPTPDNYFTLYNEIAEHPPGDEPFPEKQCKSLAAALD
RSRPAQQRLARSFDEAIRDKSWERFQNTWKAFCTEASSEPPPWSDLIAELIRQWETHHAG
LTPGKKRDSLEHVLSSAGKDPDLLFTRLKGLLTSWNQNADAGGTPLADAPEMAAEDNGAD
AVAATTAPASADNALVGELRELFAFTLETAVATQLVESPQLVEEARTLASAVRRAQDTKA
LKKLLDKLKQFAFRLELLADDQRELRTGLLHLLQLLIENVSELVEDDQWLHGQIEMVRDI
VTSPLSLRTIDDAEQRIKEVIFKQSQLKHSLSEAQEALKHMLAGFVDHLADFADSTSDYH
DKVEACAQRIATANNIADLRAVIDEVMHETRIIQLNAQRSRDELRATQQRVRESEQRVAE
LQGELDKASTLVRHDQLTGALNRHGLEEAFAKETARTQRRRTSLCLAILDIDNFKKLNDS
LGHDAGDAALIHLITVIKNTMRPTDLVARFGGEEFVILLPDTGLEDSTHALQRLQRELTK
HYFMHDNQKLLITFSAGVTAYQPGEDQAAAIKRADTAMYEAKRTGKNRVVTA