Protein Info for Dsui_1746 in Dechlorosoma suillum PS

Annotation: flagellar biosynthetic protein FliP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 49 to 76 (28 residues), see Phobius details amino acids 92 to 110 (19 residues), see Phobius details amino acids 188 to 210 (23 residues), see Phobius details amino acids 228 to 248 (21 residues), see Phobius details PF00813: FliP" amino acids 53 to 244 (192 residues), 266.9 bits, see alignment E=5.7e-84 TIGR01103: flagellar biosynthetic protein FliP" amino acids 53 to 248 (196 residues), 289.2 bits, see alignment E=8e-91

Best Hits

Swiss-Prot: 62% identical to FLIP_ECOLI: Flagellar biosynthetic protein FliP (fliP) from Escherichia coli (strain K12)

KEGG orthology group: K02419, flagellar biosynthetic protein FliP (inferred from 76% identity to app:CAP2UW1_3810)

Predicted SEED Role

"Flagellar biosynthesis protein FliP" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QG58 at UniProt or InterPro

Protein Sequence (250 amino acids)

>Dsui_1746 flagellar biosynthetic protein FliP (Dechlorosoma suillum PS)
MNLAKLRPLLLLGILLAPAVALAQAGGLPAFSSTPAPGGGQNYTLSIQTLLTLTALTFIP
AVLLMMTAFTRIIIVLSMLRHAMGLQTTPPNQVLLGLALFLTFFVMSPVADRVYTEAYVP
LAENKITFLQALEKAEQPVRGFMLKQTREADIALFAGFAGIKNIESPDKVPLRILVPAFV
TSELKTAFQIGFIIFIPFLIIDMVVGSVLMSMGMMMMSPVMVAMPFKMMLFVLVDGWHLV
LGSLVQSFAT