Protein Info for Dsui_1741 in Dechlorosoma suillum PS

Annotation: flagellar hook-associated protein FlgK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 725 TIGR02492: flagellar hook-associated protein FlgK" amino acids 6 to 331 (326 residues), 254.4 bits, see alignment E=1.4e-79 PF00460: Flg_bb_rod" amino acids 9 to 35 (27 residues), 22.4 bits, see alignment (E = 2.4e-08) PF22638: FlgK_D1" amino acids 94 to 324 (231 residues), 232.2 bits, see alignment E=1.6e-72 PF21158: flgK_1st_1" amino acids 418 to 484 (67 residues), 47.9 bits, see alignment E=2.8e-16 PF21159: FlgK_2nd" amino acids 510 to 613 (104 residues), 28.6 bits, see alignment E=4e-10 PF06429: Flg_bbr_C" amino acids 684 to 722 (39 residues), 41.5 bits, see alignment 1.9e-14

Best Hits

Predicted SEED Role

"Flagellar hook-associated protein FlgK" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QG53 at UniProt or InterPro

Protein Sequence (725 amino acids)

>Dsui_1741 flagellar hook-associated protein FlgK (Dechlorosoma suillum PS)
MSNGLFGIGITGINAAQMGLLTTGNNIANVDTPGYNRQRISQSNNISIATGSGFIGQGTR
VDTITRIYNSVVTDQINQSQTKASELSKYYDQIKQIDNMLADDKAGLSPTLQDLFKGVQT
VASNPALTTSRDALVSSAKTFTSRLQNLESRLTAMYSGVNSQLESTVSAINSYATQIAEL
NERIVTAQAAVNQPANALLDERDQLIAELNKEVRVTTSEDSNGAISVFFGTGQQLVVGTK
ASTLAVQPSVADPQRMVVGMRTVGGVQELPEYLVTGGNLGGLLAFRSESLDKAANSLGQV
AASLALTFNAQHALGQDMLGNVAGDADFNADFFNISDPKSWANALNTGTATVSASFVNPP
PMVLNGGAFSLTYDKTAGTYTAVRASDGTQWPGYTDLNSLVQQVYADTGTTLDMTSAHYA
TNITASDYRLTYDGANYTLTRLADNKQWSDADPNALSATVGASDGINFSISAGIAAGDSF
LIQPTREIARNISVNQAIAADSRLFAAAQPVRSGSGSSNTGSGVISSSTVSPGYTDPAAA
PAGTITMTFNGGNLSFSIGGVPTALTVTYTDASGTNTVSAGSVPYNNPSTKYTINGISFE
ISGNPADNDTFTLDRNSGGVSDGRNANLLGQLQTQGTVDGGASTYQASYARLVSTIGNKT
RETQVTRDAQQALVDQGVAAREAQSGVNLDEEASNLLKYQQAYQASAKMISIASDLFNTI
LSIRS