Protein Info for Dsui_1725 in Dechlorosoma suillum PS

Annotation: ATPase involved in chromosome partitioning

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 PF13614: AAA_31" amino acids 26 to 166 (141 residues), 32.5 bits, see alignment E=2e-11 PF01656: CbiA" amino acids 29 to 239 (211 residues), 42.9 bits, see alignment E=1.2e-14 PF00142: Fer4_NifH" amino acids 33 to 266 (234 residues), 31.2 bits, see alignment E=4e-11 PF06564: CBP_BcsQ" amino acids 36 to 263 (228 residues), 26.9 bits, see alignment E=8.7e-10

Best Hits

KEGG orthology group: K04562, flagellar biosynthesis protein FlhG (inferred from 60% identity to dar:Daro_0742)

Predicted SEED Role

"Flagellar synthesis regulator FleN" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QG37 at UniProt or InterPro

Protein Sequence (300 amino acids)

>Dsui_1725 ATPase involved in chromosome partitioning (Dechlorosoma suillum PS)
MEAVVAEFRGDQAAGLRRLFGREQLRVVSFAAGCEGVGKSVAVANLAAALARQGKEVLIL
DENTGADNQAALFGVPARYDLVHVVNREKPLEEVLLAAGAGVRLLPAARAVKKLSRFSLA
QKQALVEGLAEMEHPADVILVDTAVDHPLGFSPLGLAAQETVIVLSATGSAITEAYALIK
KMSTGYARRDFRILVNKVKAAADAEAIFDNIAQVASQRLHVSLDYSGCIPLDDALRQSSR
LAQPVVTAFPDSPAARSLRGLAADMLHWPQSGREGGGLEQFVQQLLHLSQRITPSPIHAG