Protein Info for Dsui_1704 in Dechlorosoma suillum PS

Annotation: flagellar motor stator protein MotA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 285 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 29 to 47 (19 residues), see Phobius details amino acids 171 to 190 (20 residues), see Phobius details amino acids 198 to 219 (22 residues), see Phobius details amino acids 240 to 253 (14 residues), see Phobius details TIGR03818: flagellar motor stator protein MotA" amino acids 1 to 280 (280 residues), 376.4 bits, see alignment E=3.9e-117 PF20560: MotA_N" amino acids 4 to 92 (89 residues), 96.3 bits, see alignment E=1.1e-31 PF01618: MotA_ExbB" amino acids 136 to 233 (98 residues), 42 bits, see alignment E=7.4e-15

Best Hits

Swiss-Prot: 54% identical to MOTA_ECOLI: Motility protein A (motA) from Escherichia coli (strain K12)

KEGG orthology group: K02556, chemotaxis protein MotA (inferred from 80% identity to app:CAP2UW1_2526)

Predicted SEED Role

"Flagellar motor rotation protein MotA" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QFM3 at UniProt or InterPro

Protein Sequence (285 amino acids)

>Dsui_1704 flagellar motor stator protein MotA (Dechlorosoma suillum PS)
MFLIIGYVVILLASVGTYAIHGSLAALWVPAEYAAIVGLVVGAFVASNSMKVIKKTVGAL
PSIFKGSKYTKALYIDLLAMLFEILAKVRKEGLMAIEADVENPESSPIFSKYPDIAGDHH
VLDFITDYLRMMVGGNLNTLEIEALMDMEIETHHHEEEVPGHAMAKVADGAPAFGIVVAV
MGVVNVMGSVGQPPAVLGKMIGGALVGTFLGILLSYGFVSPISSLLEQKAHEGSKIYQCI
KVVLLAAMSGYAPQVAIEFGRKVLFSDVRPSFRELEEELKARKGK