Protein Info for Dsui_1699 in Dechlorosoma suillum PS

Annotation: cation/cationic drug transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 118 signal peptide" amino acids 1 to 12 (12 residues), see Phobius details amino acids 32 to 32 (1 residues), see Phobius details transmembrane" amino acids 13 to 31 (19 residues), see Phobius details amino acids 43 to 64 (22 residues), see Phobius details amino acids 70 to 92 (23 residues), see Phobius details amino acids 98 to 116 (19 residues), see Phobius details PF00893: Multi_Drug_Res" amino acids 15 to 107 (93 residues), 74.4 bits, see alignment E=4.5e-25

Best Hits

Swiss-Prot: 60% identical to GDX_YERPE: Guanidinium exporter (gdx) from Yersinia pestis

KEGG orthology group: K11741, quaternary ammonium compound-resistance protein SugE (inferred from 60% identity to ypi:YpsIP31758_3671)

Predicted SEED Role

"Quaternary ammonium compound-resistance protein SugE"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QFL8 at UniProt or InterPro

Protein Sequence (118 amino acids)

>Dsui_1699 cation/cationic drug transporter (Dechlorosoma suillum PS)
MFSPATVFSLSPLLAWAVLLLAGLLEIGWALGLKSAAASSRPALMWSATLAAMAASVGLL
ALALKQLPLGLAYAVWTAIGIAGTALVGIFLLGESASPLRLCSIGLILAGVAGLKLSA