Protein Info for Dsui_1691 in Dechlorosoma suillum PS

Annotation: DNA segregation ATPase, FtsK/SpoIIIE family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 771 transmembrane" amino acids 31 to 48 (18 residues), see Phobius details amino acids 79 to 101 (23 residues), see Phobius details amino acids 117 to 141 (25 residues), see Phobius details amino acids 161 to 186 (26 residues), see Phobius details PF13491: FtsK_4TM" amino acids 26 to 199 (174 residues), 151.2 bits, see alignment E=4.6e-48 PF17854: FtsK_alpha" amino acids 283 to 383 (101 residues), 96.4 bits, see alignment E=2e-31 PF01580: FtsK_SpoIIIE" amino acids 391 to 600 (210 residues), 251.2 bits, see alignment E=1.6e-78 PF09397: FtsK_gamma" amino acids 706 to 765 (60 residues), 88.5 bits, see alignment 3.8e-29

Best Hits

Swiss-Prot: 67% identical to FTSK2_RALSO: DNA translocase FtsK 2 (ftsK2) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K03466, DNA segregation ATPase FtsK/SpoIIIE, S-DNA-T family (inferred from 74% identity to dar:Daro_1295)

Predicted SEED Role

"Cell division protein FtsK" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton or Bacterial RNA-metabolizing Zn-dependent hydrolases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QFL2 at UniProt or InterPro

Protein Sequence (771 amino acids)

>Dsui_1691 DNA segregation ATPase, FtsK/SpoIIIE family (Dechlorosoma suillum PS)
MAVPQSARRNSDKSPSPLPEKIAVILQESRWLALVVFAGFLSLALWGYDRADPGWSHAAQ
VDALHNPAGRFGAWLSDLLLYLFGASAWWWVTLMLALVWWGYRRLDGLRGNGDRRPLIVA
AIGFLILLVASCGLEAIRFYTLRTPLPLVPGGMLGLELGNAAVAALGYTGATLVLLTGVV
LGWSLFSGMSWLSTFERLGTLVEGTYFGIRGLIERWQDQRIGREVAREREAVVEVERARV
EDHEPIRIEIVEPEIEVSTKVEKRIERERQAPLFPEAVEGGQLPPLHLLDPAPPQTDLPA
ADTLEFTSRLIERKLADFGVQVKVLAAYPGPVITRYEIEPAVGVKGAQIVNLARDLARAL
ALISVRVVETVPGKSCMALELPNPKRQAVRLSEILSSKAYYDMASPLTVALGKDIGGQAT
VADLAKMPHLLVAGTTGSGKSVGINAMILSLLYKSTAKDVRLILVDPKMLELSIYEGIPH
LLAPVVTDMRQAANALNWCVGEMEKRYKLMSAMGVRNLAGFNAKIREAEKNEQKIPNPLS
ITPESPEPLTELPYIVVVIDELADLMMVVGKKVEELIARLAQKARAAGIHLILATQRPSV
DVITGLIKANIPTRISFQVSSKIDSRTILDQMGAEALLGQGDMLYLTPGSGYPTRVHGAF
VADDEVHHVVEYLKKTGAPDYIEDVLSGAGGDEDGGGDGEGGDDPENDPMYDQAVEIVLK
TRRASISLVQRNLRIGYNRASRLIEAMERAGLVSAMDGRGGREVLGRKTEE