Protein Info for Dsui_1687 in Dechlorosoma suillum PS
Annotation: nitrogen regulatory protein PII
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 73% identical to GLNB_KLEOX: Nitrogen regulatory protein P-II (glnB) from Klebsiella oxytoca
KEGG orthology group: K04751, nitrogen regulatory protein P-II 1 (inferred from 88% identity to dar:Daro_1291)MetaCyc: 73% identical to nitrogen regulatory protein PII-1 (Escherichia coli K-12 substr. MG1655)
Predicted SEED Role
"Nitrogen regulatory protein P-II" in subsystem Ammonia assimilation
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See G8QFK8 at UniProt or InterPro
Protein Sequence (112 amino acids)
>Dsui_1687 nitrogen regulatory protein PII (Dechlorosoma suillum PS) MKKIEAIIKPFKLDEVREALSEIGVTGLTVTEVKGFGRQKGHTELYRGAEYVVDFLPKIK VELIISDDKVEPAIDAIVKAAHTGKIGDGKIFVMPVEQVVRIRTGETDEAAI