Protein Info for Dsui_1684 in Dechlorosoma suillum PS

Annotation: TonB family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 219 signal peptide" amino acids 20 to 21 (2 residues), see Phobius details amino acids 40 to 40 (1 residues), see Phobius details transmembrane" amino acids 22 to 39 (18 residues), see Phobius details PF03544: TonB_C" amino acids 139 to 217 (79 residues), 78.2 bits, see alignment E=2.6e-26 TIGR01352: TonB family C-terminal domain" amino acids 141 to 217 (77 residues), 71 bits, see alignment E=4.1e-24

Best Hits

Swiss-Prot: 34% identical to TONB_XANCB: Protein TonB (tonB) from Xanthomonas campestris pv. campestris (strain B100)

KEGG orthology group: K03832, periplasmic protein TonB (inferred from 44% identity to del:DelCs14_2188)

Predicted SEED Role

"Ferric siderophore transport system, periplasmic binding protein TonB" in subsystem Campylobacter Iron Metabolism or Hemin transport system or Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QFK5 at UniProt or InterPro

Protein Sequence (219 amino acids)

>Dsui_1684 TonB family protein (Dechlorosoma suillum PS)
MLVPAMPYSCPTDSGWLSRSPWVGAAVLLHGAALAWALGTAQPSPIEAPQVMNIALVTPA
PEPAAKPTPTPPPPKPQPVVKQQAPAPKAVKSEPAPAPTPASITSSAPPPPAPAAAPPGP
AAPAPVVEAKFDADYLQNPKPTYPPASKRLGEQGKVWLRAHVLPNGTTDNVELKQTSGSP
RLDAAALEAVKRWRFVPARQGSEAVASWVVIPVSFSLES