Protein Info for Dsui_1677 in Dechlorosoma suillum PS
Annotation: ribosomal protein S4, bacterial/organelle type
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 60% identical to RS4_METFK: 30S ribosomal protein S4 (rpsD1) from Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875)
KEGG orthology group: K02986, small subunit ribosomal protein S4 (inferred from 62% identity to tmz:Tmz1t_3530)MetaCyc: 40% identical to 30S ribosomal subunit protein S4 (Escherichia coli K-12 substr. MG1655)
Predicted SEED Role
"SSU ribosomal protein S4p (S9e)" in subsystem Ribosome SSU bacterial
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See G8QFJ8 at UniProt or InterPro
Protein Sequence (205 amino acids)
>Dsui_1677 ribosomal protein S4, bacterial/organelle type (Dechlorosoma suillum PS) MSRHTGPRLKIMRALGTELPGLSRKTRGEREQPPGQHGARKVAGRKSEFGLQLMEKQKLR FNYGVSETQLRRIVKDARRDQGATGHKIVELLERRLDNLVFRAGLAPTIPAARQLVSHGH IALNGRRATIPSIRVKAGDAFGPVEKSRNLLAIKASLAEPALERPEWIAFEEASLTARLS HLPDGDAAPFPLDLQRVVEYYATRL