Protein Info for Dsui_1677 in Dechlorosoma suillum PS

Annotation: ribosomal protein S4, bacterial/organelle type

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 205 PF00163: Ribosomal_S4" amino acids 3 to 93 (91 residues), 72 bits, see alignment E=5.6e-24 TIGR01017: ribosomal protein uS4" amino acids 3 to 202 (200 residues), 206.5 bits, see alignment E=1.8e-65 PF01479: S4" amino acids 94 to 139 (46 residues), 64.7 bits, see alignment 5.2e-22

Best Hits

Swiss-Prot: 60% identical to RS4_METFK: 30S ribosomal protein S4 (rpsD1) from Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875)

KEGG orthology group: K02986, small subunit ribosomal protein S4 (inferred from 62% identity to tmz:Tmz1t_3530)

MetaCyc: 40% identical to 30S ribosomal subunit protein S4 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"SSU ribosomal protein S4p (S9e)" in subsystem Ribosome SSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QFJ8 at UniProt or InterPro

Protein Sequence (205 amino acids)

>Dsui_1677 ribosomal protein S4, bacterial/organelle type (Dechlorosoma suillum PS)
MSRHTGPRLKIMRALGTELPGLSRKTRGEREQPPGQHGARKVAGRKSEFGLQLMEKQKLR
FNYGVSETQLRRIVKDARRDQGATGHKIVELLERRLDNLVFRAGLAPTIPAARQLVSHGH
IALNGRRATIPSIRVKAGDAFGPVEKSRNLLAIKASLAEPALERPEWIAFEEASLTARLS
HLPDGDAAPFPLDLQRVVEYYATRL