Protein Info for Dsui_1636 in Dechlorosoma suillum PS

Annotation: poly(3-hydroxyalkanoate) synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 585 PF07167: PhaC_N" amino acids 95 to 263 (169 residues), 207.7 bits, see alignment E=1.1e-65 PF00561: Abhydrolase_1" amino acids 256 to 512 (257 residues), 57.8 bits, see alignment E=1.3e-19

Best Hits

KEGG orthology group: None (inferred from 69% identity to dar:Daro_0993)

Predicted SEED Role

"Polyhydroxyalkanoic acid synthase" in subsystem Polyhydroxybutyrate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QFF7 at UniProt or InterPro

Protein Sequence (585 amino acids)

>Dsui_1636 poly(3-hydroxyalkanoate) synthetase (Dechlorosoma suillum PS)
MAANPNSASSSKHHKSINLSGASPLEDMGEKLEKQVDPFGITTSMLNAQAAWLMHPQELS
RVMTGLSGDLLALQAHVMRRALGLPSEDVVRPHEDDSRFSDPVWEQSPTWDIMKEWYLAM
THRLEDMYFETPGLSDKERRRAAFWLRKWLNAVAPTNFFWTNPVALRKFVESKGESLARG
MENYLKDSQSGTVRMVDEDAFKVGVDLATTPGQVVFRNRLVELIQYTPTTAQVYKQPIVI
VTPWINKFYILDLTAKKSLVRYLVEKGFTVFITSWKNPTEDMSQVTYEDYVTEGVHEVME
AARTICKVPQVNAVGYCIGGTTLTAYMAWANRKFGSADKVPVSSWTLFTTLTDFSRPGDI
EVFVDPASVKWIEDSMAKKGYLDGKEMMSSFRMLRSNSLIWHYYVHSYLYGEPLAPFDVL
FWNVDSTRMPYAMHSYYLREMYLNNNLVKKDALTIGGEAIDLERITQPLYAVTAEDDHIA
PWRQCYRIRKYVSAPTRFVLSTSGHILGIVNPPVNPPKRSYWVGEPERGENIERWEAAAE
KRPGSWWEDWVQWLVPKSGALVAPPKPHKDFPALAPAPGTYVLEP