Protein Info for Dsui_1635 in Dechlorosoma suillum PS

Annotation: putative exonuclease of the beta-lactamase fold involved in RNA processing

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 474 PF00753: Lactamase_B" amino acids 16 to 80 (65 residues), 40.2 bits, see alignment E=9e-14 PF16661: Lactamase_B_6" amino acids 24 to 181 (158 residues), 32.9 bits, see alignment E=1.1e-11 PF12706: Lactamase_B_2" amino acids 31 to 103 (73 residues), 30.9 bits, see alignment E=5.4e-11 PF10996: Beta-Casp" amino acids 263 to 388 (126 residues), 126.6 bits, see alignment E=1.9e-40 PF07521: RMMBL" amino acids 402 to 462 (61 residues), 64.5 bits, see alignment E=1.9e-21

Best Hits

KEGG orthology group: K07576, metallo-beta-lactamase family protein (inferred from 67% identity to dar:Daro_0992)

Predicted SEED Role

"Metallo-beta-lactamase family protein, RNA-specific" in subsystem Bacterial RNA-metabolizing Zn-dependent hydrolases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QFF6 at UniProt or InterPro

Protein Sequence (474 amino acids)

>Dsui_1635 putative exonuclease of the beta-lactamase fold involved in RNA processing (Dechlorosoma suillum PS)
MSLQGKIQVSMHGAAGEVTGSCTLVEMEGLRFLVDCGMFQGGGDAYGKNQRALAFDVRHL
DFVLLTHAHIDHSGLLPRLAMLGYRGPIYATAATTDLLQVLLLDSAHIQEKESEWQLRRS
HRSGRGGRGLQPPLYTVTQAQECLKLLRAVDYDTPLHPASGVSVRFRDAGHILGSAILEV
QIDTADGPRKLVFSGDLGQPGRPVLRDPEFIAEADLLCIESTYGNRVHRPLEDTEAELIR
AFEHTFGEKRGNIIIPAFAVGRTQEILYVLGGLVRQGRLPHLKIYVDSPMADAATRITLK
YRHLWDDETRDLMAWQEANPQAVRVHFTADVEESMALNDIREGAVIISASGMCDAGRIKH
HLAYNLPRPESTVLITGFQAAGTLGRRLVDGARTVRLFGQIVPVRADVHTIGGLSAHADQ
QALLDWVGHFSRAPGQVRVVHGEPEAAEALRDAIEQRYGWANVAVARCNDPVIV