Protein Info for Dsui_1631 in Dechlorosoma suillum PS

Annotation: cytochrome c oxidase accessory protein FixG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 470 transmembrane" amino acids 37 to 57 (21 residues), see Phobius details amino acids 64 to 65 (2 residues), see Phobius details amino acids 72 to 79 (8 residues), see Phobius details amino acids 85 to 106 (22 residues), see Phobius details amino acids 158 to 175 (18 residues), see Phobius details amino acids 194 to 212 (19 residues), see Phobius details amino acids 339 to 358 (20 residues), see Phobius details TIGR02745: cytochrome c oxidase accessory protein CcoG" amino acids 34 to 468 (435 residues), 507.8 bits, see alignment E=1.3e-156 PF12801: Fer4_5" amino acids 88 to 129 (42 residues), 35.7 bits, see alignment 2.4e-12 PF13746: Fer4_18" amino acids 212 to 317 (106 residues), 150.1 bits, see alignment E=9.8e-48 PF11614: FixG_C" amino acids 354 to 470 (117 residues), 114 bits, see alignment E=1.7e-36

Best Hits

KEGG orthology group: None (inferred from 71% identity to dar:Daro_0717)

Predicted SEED Role

"Type cbb3 cytochrome oxidase biogenesis protein CcoG, involved in Cu oxidation" in subsystem Biogenesis of cbb3-type cytochrome c oxidases or Terminal cytochrome C oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QPV9 at UniProt or InterPro

Protein Sequence (470 amino acids)

>Dsui_1631 cytochrome c oxidase accessory protein FixG (Dechlorosoma suillum PS)
MSQIENGNSAVPEANGSLYEKHKKIYVRAASGLFNNWRWGMVFLTQALFYGLCWVDWNGR
QAVLFHLVERKFYIFGMVFWPQDVFYLALLLIISAYALFLFTAVAGRLFCGYACPQTVYT
ELFLWIEAKVEGDRPARMKLDKGPLDGRKLRLKTTKHALWLILSLWTGFTLVGYFTPVKE
LVASIPSFGFGPWEIFWILFYAGFTYMQAGFLREQVCKYMCPYARFQGVMFDPDTLIITY
DPERGEPRGARKKGIDPRSEGKGDCVDCGICVQVCPTGIDIRNGLQYECIGCSACIDACD
EVMDKMSYPRGLIRYSTENALAKHYTPKEMVAHVMRPRVLLYSAILGMIILATAWGLGTR
IPLKVDVIRDRATLAREADDGRIENIYTLRIMNTEEAPRRYALSVSGLPGAEIIGERIVE
VPAATTESVLVSVRVPPESGTKGANHIFFEIQAQNHDKVRVSEKASFMLP