Protein Info for Dsui_1624 in Dechlorosoma suillum PS

Annotation: dehydrogenase of unknown specificity, short-chain alcohol dehydrogenase like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF08659: KR
  • amino acids 7 to 194 (188 residues), 37.9 bits, E=2.7e-13
• PF00106: adh_short
  • amino acids 7 to 203 (197 residues), 158.6 bits, E=2.1e-50
• PF13561: adh_short_C2
  • amino acids 15 to 248 (234 residues), 148 bits, E=5.3e-47

Best Hits

Swiss-Prot: 57% identical to HCD2_BOVIN: 3-hydroxyacyl-CoA dehydrogenase type-2 (HSD17B10) from Bos taurus

KEGG orthology group: None (inferred from 80% identity to azo:azo1338)

MetaCyc: 66% identical to 3-hydroxy-2-methylbutyryl-CoA dehydrogenase subunit (Pseudomonas putida)
3-hydroxy-2-methylbutyryl-CoA dehydrogenase. [EC: 1.1.1.178]

Predicted SEED Role

"3-hydroxyacyl-CoA dehydrogenase (EC 1.1.1.35) @ 17hydroxysteroid dehydrogenase type 10 (HSD10)-like" (EC 1.1.1.35)

MetaCyc Pathways

• oleate β-oxidation (28/35 steps found)
• superpathway of glyoxylate cycle and fatty acid degradation (11/14 steps found)
• benzoyl-CoA biosynthesis (3/3 steps found)
• fatty acid salvage (5/6 steps found)
• pyruvate fermentation to butanol II (engineered) (5/6 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (20/27 steps found)
• adipate degradation (4/5 steps found)
• fatty acid β-oxidation I (generic) (5/7 steps found)
• L-isoleucine degradation I (4/6 steps found)
• (R)- and (S)-3-hydroxybutanoate biosynthesis (engineered) (3/5 steps found)
• adipate biosynthesis (3/5 steps found)
• fatty acid β-oxidation II (plant peroxisome) (3/5 steps found)
• glutaryl-CoA degradation (3/5 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (18/26 steps found)
• pyruvate fermentation to hexanol (engineered) (7/11 steps found)
• fatty acid β-oxidation VI (mammalian peroxisome) (4/7 steps found)
• 2-methyl-branched fatty acid β-oxidation (9/14 steps found)
• methyl ketone biosynthesis (engineered) (3/6 steps found)
• propanoate fermentation to 2-methylbutanoate (3/6 steps found)
• superpathway of Clostridium acetobutylicum acidogenic fermentation (5/9 steps found)
• valproate β-oxidation (5/9 steps found)
• glycerol degradation to butanol (10/16 steps found)
• 4-hydroxybenzoate biosynthesis III (plants) (2/5 steps found)
• pyruvate fermentation to butanol I (4/8 steps found)
• pyruvate fermentation to butanoate (3/7 steps found)
• 3-hydroxypropanoate/4-hydroxybutanate cycle (10/18 steps found)
• benzoyl-CoA degradation I (aerobic) (2/7 steps found)
• 3-phenylpropanoate degradation (4/10 steps found)
• L-glutamate degradation V (via hydroxyglutarate) (4/10 steps found)
• benzoate biosynthesis I (CoA-dependent, β-oxidative) (3/9 steps found)
• phenylacetate degradation I (aerobic) (3/9 steps found)
• 2-methylpropene degradation (2/8 steps found)
• superpathway of Clostridium acetobutylicum solventogenic fermentation (5/13 steps found)
• superpathway of phenylethylamine degradation (3/11 steps found)
• methyl tert-butyl ether degradation (2/10 steps found)
• superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (7/17 steps found)
• L-glutamate degradation VII (to butanoate) (3/12 steps found)
• L-tryptophan degradation III (eukaryotic) (3/15 steps found)
• crotonate fermentation (to acetate and cyclohexane carboxylate) (3/16 steps found)
• benzoate fermentation (to acetate and cyclohexane carboxylate) (3/17 steps found)
• toluene degradation VI (anaerobic) (3/18 steps found)
• cholesterol degradation to androstenedione I (cholesterol oxidase) (2/17 steps found)
• androstenedione degradation I (aerobic) (6/25 steps found)
• platensimycin biosynthesis (6/26 steps found)
• cholesterol degradation to androstenedione II (cholesterol dehydrogenase) (3/22 steps found)
• superpathway of testosterone and androsterone degradation (6/28 steps found)
• androstenedione degradation II (anaerobic) (4/27 steps found)
• superpathway of cholesterol degradation I (cholesterol oxidase) (8/42 steps found)
• superpathway of cholesterol degradation II (cholesterol dehydrogenase) (9/47 steps found)
• superpathway of cholesterol degradation III (oxidase) (5/49 steps found)

KEGG Metabolic Maps

• Benzoate degradation via CoA ligation
• Bile acid biosynthesis
• Biosynthesis of plant hormones
• Butanoate metabolism
• Caprolactam degradation
• Fatty acid elongation in mitochondria
• Fatty acid metabolism
• Geraniol degradation
• Lysine degradation
• Tryptophan metabolism
• Valine, leucine and isoleucine degradation

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.35

Use Curated BLAST to search for 1.1.1.178 or 1.1.1.35

Sequence Analysis Tools

See G8QPV2 at UniProt or InterPro

Protein Sequence (255 amino acids)

>Dsui_1624 dehydrogenase of unknown specificity, short-chain alcohol dehydrogenase like protein (Dechlorosoma suillum PS)
MELKESVFVVTGGGSGLGAATARMIVAGGGKVVLADVNKAAGEALAAELGANARFAETDV
TNEASAKAAVELAVSTFGKLNGLVNCAGVAPAEKVLGKEGPHRLESFAKVININLVGSFN
MIRLATEVMAKGEPNAQGERGVIVSTASVAAFDGQLGQAAYAASKGGVVAMTLPIARELA
RSGIRVMTIAPGIMETPMLMGMPQEVQDSLGKMVPFPSRMGKPAEYAALVRHIVENSYLN
GEVIRLDGAIRMAAK