Protein Info for Dsui_1609 in Dechlorosoma suillum PS

Annotation: Thiopurine S-methyltransferase (TPMT)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 205 PF05724: TPMT" amino acids 17 to 179 (163 residues), 109.7 bits, see alignment E=4.3e-35 PF13649: Methyltransf_25" amino acids 55 to 146 (92 residues), 39.2 bits, see alignment E=2.4e-13 PF08241: Methyltransf_11" amino acids 58 to 149 (92 residues), 37.3 bits, see alignment E=8.8e-13 PF08242: Methyltransf_12" amino acids 59 to 148 (90 residues), 32.5 bits, see alignment E=3e-11

Best Hits

KEGG orthology group: None (inferred from 49% identity to bmj:BMULJ_02690)

Predicted SEED Role

"SAM-dependent methyltransferases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QPT9 at UniProt or InterPro

Protein Sequence (205 amino acids)

>Dsui_1609 Thiopurine S-methyltransferase (TPMT) (Dechlorosoma suillum PS)
MTQAPSAKPDHQRPELPDFWDKRFAAGATPWDHGSAPAELEALLPPPACATPPRILVPGC
GHAREAAWLDQRGWAVTALDFAPAAIAAAREVLGEWGGELRCADFFDFPVEAPYDVVYER
AFLCALPRKLWPGYGPRAAELVRPGGYLAGFFFFSDEPKGPPFGIGAAEQEALLSPWFER
MVDAPAQAPIPVFAGGERWQVWRRR