Protein Info for Dsui_1594 in Dechlorosoma suillum PS

Annotation: Factor for inversion stimulation Fis, transcriptional activator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 79 PF02954: HTH_8" amino acids 36 to 74 (39 residues), 57.5 bits, see alignment E=4.6e-20

Best Hits

Swiss-Prot: 58% identical to FISL_NEIMA: Putative Fis-like DNA-binding protein (NMA1632) from Neisseria meningitidis serogroup A / serotype 4A (strain Z2491)

KEGG orthology group: K03557, Fis family transcriptional regulator, factor for inversion stimulation protein (inferred from 74% identity to dar:Daro_3666)

Predicted SEED Role

"DNA-binding protein Fis" in subsystem DNA structural proteins, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QPS4 at UniProt or InterPro

Protein Sequence (79 amino acids)

>Dsui_1594 Factor for inversion stimulation Fis, transcriptional activator (Dechlorosoma suillum PS)
MSRNNNDISACVFGALEQYFRDLDGERPAAIYDMVMRNVEKPMLQIVLQQAGGNQTLAAE
MLGINRNTLRKKLVDYKLI