Protein Info for Dsui_1586 in Dechlorosoma suillum PS

Annotation: parvulin-like peptidyl-prolyl isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 437 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF13624: SurA_N_3" amino acids 4 to 151 (148 residues), 63.5 bits, see alignment E=6.4e-21 PF13623: SurA_N_2" amino acids 35 to 112 (78 residues), 34.7 bits, see alignment E=4.9e-12 PF09312: SurA_N" amino acids 36 to 152 (117 residues), 153.5 bits, see alignment E=8.3e-49 PF13616: Rotamase_3" amino acids 181 to 282 (102 residues), 66.1 bits, see alignment E=1.2e-21 amino acids 291 to 390 (100 residues), 88.6 bits, see alignment E=1.3e-28 PF13145: Rotamase_2" amino acids 181 to 285 (105 residues), 39.9 bits, see alignment E=2.1e-13 amino acids 312 to 391 (80 residues), 34.8 bits, see alignment E=8.1e-12 PF00639: Rotamase" amino acids 187 to 279 (93 residues), 78.1 bits, see alignment E=2.4e-25 amino acids 298 to 387 (90 residues), 83.5 bits, see alignment E=5.2e-27

Best Hits

Swiss-Prot: 65% identical to SURA_DECAR: Chaperone SurA (surA) from Dechloromonas aromatica (strain RCB)

KEGG orthology group: K03771, peptidyl-prolyl cis-trans isomerase SurA [EC: 5.2.1.8] (inferred from 68% identity to app:CAP2UW1_0808)

Predicted SEED Role

"Survival protein SurA precursor (Peptidyl-prolyl cis-trans isomerase SurA) (EC 5.2.1.8)" in subsystem Peptidyl-prolyl cis-trans isomerase (EC 5.2.1.8)

Isozymes

Compare fitness of predicted isozymes for: 5.2.1.8

Use Curated BLAST to search for 5.2.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QPR6 at UniProt or InterPro

Protein Sequence (437 amino acids)

>Dsui_1586 parvulin-like peptidyl-prolyl isomerase (Dechlorosoma suillum PS)
MQTMMKYWLSLLLCLAACQANAQTYRGQRTDPVEADRIIAVVNSEVITLNELRQRLDSVV
SQLRRQGTPLPPADVLEKQMLERMVVDKVQVQFAKENGIRIEDAQLDMALNRIAANNKMT
LAQFRQALEKDGIAFAKFREEIRQEITVSRLREREVDAKLLVSEGEIDNYLAGASAGGSA
EEYQVAHILVRSPESASPEQLQKLKAKAEQILDRLKRGEDFAQVAAAYSDAPDALQGGNL
GFRPLDRMPNIFAETVQKMQPSQLSPVIRSPNGFHIVKLVAKKGGASIPAVQQTHARHIL
IKVNEVVSEAEAKRKLQAVKERLDHGGDFAELARLYSQDGSAPKGGDLDWLYPGDTVPEF
ERAMDALKVGEVSQPVQSMFGWHLIQVLERRVQDVSQDRQRAIARNALRERKSDEAYQDW
LRQLRDRAYVEYRWEEQ