Protein Info for Dsui_1583 in Dechlorosoma suillum PS

Annotation: (4Fe-4S) cluster-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00273: iron-sulfur cluster-binding protein
  • amino acids 18 to 452 (435 residues), 494.4 bits, E=1.4e-152
• PF02589: LUD_dom
  • amino acids 68 to 293 (226 residues), 170.2 bits, E=1.9e-53
• PF13183: Fer4_8
  • amino acids 307 to 375 (69 residues), 47.7 bits, E=8.5e-16
• PF13534: Fer4_17
  • amino acids 310 to 375 (66 residues), 30.6 bits, E=1.8e-10
• PF12800: Fer4_4
  • amino acids 310 to 324 (15 residues), 16.5 bits, see alignment (E = 4e-06)
  • amino acids 359 to 373 (15 residues), 12.7 bits, see alignment (E = 6.6e-05)
• PF12838: Fer4_7
  • amino acids 310 to 374 (65 residues), 30 bits, E=2.6e-10
• PF11870: LutB_C
  • amino acids 386 to 467 (82 residues), 45.1 bits, E=4.7e-15

Best Hits

Swiss-Prot: 47% identical to LUTB_LYSSC: Lactate utilization protein B (lutB) from Lysinibacillus sphaericus (strain C3-41)

KEGG orthology group: None (inferred from 62% identity to eba:ebA4051)

MetaCyc: 46% identical to component of an iron-sulfur oxidase linked to L-lactate utilization (Bacillus subtilis subtilis 168)
L-lactate dehydrogenase. [EC: 1.1.1.27]

Predicted SEED Role

"Predicted L-lactate dehydrogenase, Iron-sulfur cluster-binding subunit YkgF" in subsystem L-rhamnose utilization or Lactate utilization

MetaCyc Pathways

• superpathway of anaerobic sucrose degradation (16/19 steps found)
• Bifidobacterium shunt (13/15 steps found)
• homolactic fermentation (10/12 steps found)
• pyruvate fermentation to acetate and (S)-lactate I (4/4 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (14/19 steps found)
• pyruvate fermentation to (S)-lactate (1/1 steps found)
• pyruvate fermentation to acetate and lactate II (3/4 steps found)
• heterolactic fermentation (11/18 steps found)
• superpathway of glucose and xylose degradation (10/17 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (7/13 steps found)

KEGG Metabolic Maps

• Cysteine metabolism
• Glycolysis / Gluconeogenesis
• Propanoate metabolism
• Pyruvate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.27

Sequence Analysis Tools

See G8QPR3 at UniProt or InterPro

Protein Sequence (470 amino acids)

>Dsui_1583 (4Fe-4S) cluster-containing protein (Dechlorosoma suillum PS)
MEIHSNDFKARAREALANPNLQKALKLVQVKFVPGRAAAAAEFGDFETLRDAGRDIRNRA
LENLDLWLERFEQEATRRGAQVHWARDAAEANAIIVGIAQANGVKKVVKSKSMVSEECGL
NDALEAAGVTPVETDLGEYILQINDHEPPSHIVAPVIHKTRDEVSDLFHAKHGKPRTEDI
GALCREAREILRPHFLSADMGISGANFLVAETGSTVIVTNEGNGRLCTTVPRIHVALTGI
EKVVPTLEDLSVLLRLLPRSATGQPITNYVSMNTGVAGSGDSDGPEQFHIVLLDNGRSRV
LGSELKEMLRCIRCGACMNHCPVYQAVGGHAYGWVYPGPMGSVLTPSYAGMEHAHELPHT
ATGCGQCSAVCPVRIPLPELMRKEREMQVEAGLRPWQERLSLKLWGWSASQSWLYGIGTA
IAARFLKRLGGADQLIHRLPLGGGWTDGRDFPAPAGKTFRELYRARKNLH