Protein Info for Dsui_1581 in Dechlorosoma suillum PS

Annotation: response regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 216 PF00072: Response_reg" amino acids 18 to 127 (110 residues), 102.9 bits, see alignment E=1.7e-33 PF08281: Sigma70_r4_2" amino acids 147 to 196 (50 residues), 28.4 bits, see alignment E=1.6e-10 PF00196: GerE" amino acids 153 to 208 (56 residues), 78.4 bits, see alignment E=3.6e-26

Best Hits

Swiss-Prot: 48% identical to FIXJ_AZOC5: Transcriptional regulatory protein FixJ (fixJ) from Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571)

KEGG orthology group: None (inferred from 69% identity to azo:azo1376)

Predicted SEED Role

"Nitrogen regulation protein NR(I)" in subsystem Ammonia assimilation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QPR1 at UniProt or InterPro

Protein Sequence (216 amino acids)

>Dsui_1581 response regulator (Dechlorosoma suillum PS)
MTQHNSQESAAVASTQCVYVVDDDEAMRDSMVWLIESEGYPVRAFPSAEDFLAAYTDGLA
GCLVLDVRMPGMSGLELYERLAAQRSTLPVIFITGHGDVPMAVAALKKGAADFIEKPFND
TDMLRLIRQCMDLDTERRARRARENSVASRLAQLTAREREVMDRVVEGKLNKQIADELSI
SMKTVEAHRARVMEKMGVRSLAELVQCALESSQAER