Protein Info for Dsui_1571 in Dechlorosoma suillum PS

Annotation: Fe-S cluster protector protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 90 PF04362: Iron_traffic" amino acids 1 to 88 (88 residues), 143 bits, see alignment E=1e-46

Best Hits

Swiss-Prot: 84% identical to FETP_DECAR: Probable Fe(2+)-trafficking protein (Daro_3583) from Dechloromonas aromatica (strain RCB)

KEGG orthology group: None (inferred from 84% identity to dar:Daro_3583)

Predicted SEED Role

"FIG001341: Probable Fe(2+)-trafficking protein YggX" in subsystem Heat shock dnaK gene cluster extended

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QPQ1 at UniProt or InterPro

Protein Sequence (90 amino acids)

>Dsui_1571 Fe-S cluster protector protein (Dechlorosoma suillum PS)
MARTVNCIKLGREAEGLDFAPYPGELGKRIFENVSKEAWQQWIRLQTMIINENRLNLADQ
RHRQYLAEQLEKHFFGEGAEQVQGFVPPQS