Protein Info for Dsui_1568 in Dechlorosoma suillum PS

Annotation: RNA methyltransferase, RsmE family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 249 TIGR00046: RNA methyltransferase, RsmE family" amino acids 21 to 245 (225 residues), 178.6 bits, see alignment E=6.7e-57 PF20260: PUA_4" amino acids 28 to 69 (42 residues), 50.4 bits, see alignment 2e-17 PF04452: Methyltrans_RNA" amino acids 78 to 240 (163 residues), 172.5 bits, see alignment E=5.6e-55

Best Hits

KEGG orthology group: K09761, ribosomal RNA small subunit methyltransferase E [EC: 2.1.1.-] (inferred from 63% identity to dar:Daro_3586)

Predicted SEED Role

"Ribosomal RNA small subunit methyltransferase E (EC 2.1.1.-)" in subsystem Heat shock dnaK gene cluster extended (EC 2.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QPP8 at UniProt or InterPro

Protein Sequence (249 amino acids)

>Dsui_1568 RNA methyltransferase, RsmE family (Dechlorosoma suillum PS)
MTDPRFFCSPEALSLSPGASVDLPEGPARHAARVLRLQAGDGLILFNGRGGEYGACIEAV
AKDRVRVRLGEHQPRECESPLALTLIQALQGGDKMDFTLQKAVELGVSRFQPVSSRRSVV
RLDGERAAKRLEHWRGVAVSACEQCGRNRLPEVAPLLPLERALGQAESASRRLVLLPGAA
VSLAAMAPPDGPVSLLVGAEGGLAPEEAEAAVAAGFTPVSLGPRVLRTETAGLAALAAIQ
ALWGDFRGG