Protein Info for Dsui_1567 in Dechlorosoma suillum PS

Annotation: Peroxiredoxin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 186 PF00578: AhpC-TSA" amino acids 12 to 136 (125 residues), 52.5 bits, see alignment E=4.8e-18 PF08534: Redoxin" amino acids 14 to 151 (138 residues), 49.5 bits, see alignment E=4.2e-17

Best Hits

KEGG orthology group: None (inferred from 68% identity to eba:ebA1095)

Predicted SEED Role

"PPO candidate 1"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QPP7 at UniProt or InterPro

Protein Sequence (186 amino acids)

>Dsui_1567 Peroxiredoxin (Dechlorosoma suillum PS)
MVSLTTPLCDFGWQAPDFLLPGTDGRQHGPASARGPRGLLVMFICNHCPYVKAILEHLVR
DCRELRDHHGIGSIAVMSNDTAAYPEDGFAQMQALASQWDLPFPYVLDDSQAVARAYGAV
CTPDFFGFNADLQLQYRGRLDDTGRNAPRPDARRELFEAMTLVAAGGRGPAEQTPSIGCS
LKWRDT