Protein Info for Dsui_1540 in Dechlorosoma suillum PS

Annotation: NAD(FAD)-dependent dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 431 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details PF00070: Pyr_redox" amino acids 40 to 77 (38 residues), 22.6 bits, see alignment 3.7e-08 PF07992: Pyr_redox_2" amino acids 40 to 144 (105 residues), 42.1 bits, see alignment E=2.2e-14 PF21706: FCSD_central" amino acids 173 to 286 (114 residues), 148.2 bits, see alignment E=3.3e-47 PF09242: FCSD-flav_bind" amino acids 364 to 430 (67 residues), 73.7 bits, see alignment E=3.5e-24

Best Hits

KEGG orthology group: K00540, [EC: 1.-.-.-] (inferred from 70% identity to dar:Daro_3137)

Predicted SEED Role

"Sulfide dehydrogenase [flavocytochrome C] flavoprotein chain precursor (EC 1.8.2.-)" in subsystem Sulfur oxidation (EC 1.8.2.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.- or 1.8.2.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QP76 at UniProt or InterPro

Protein Sequence (431 amino acids)

>Dsui_1540 NAD(FAD)-dependent dehydrogenase (Dechlorosoma suillum PS)
MTMQRRDFLKAAGIVSAASVTASLTGCASAPVPRKQAAGHVVVVGGGYGGATVAKYLRKW
SEGGVRVTLVERNPTFISCPISNLILSGDKTLDDITVSYDGLKNRWGVKVIQDEAVAVDP
VKRTLRLAQGGSLSYDRLVLSPGVDFLWSLVPALDAKESQEKILHAWKAGPQTVALRKQL
ESMKDGGVFAITIPKAPYRCPPGPYERASVVASYFKAHKPKSKVLILDANEDVISKKGLF
TKAWSELYPNIVEYRPNHELIDVDVTNTTALFEFDKVRADVLNVVPPQRAGAIASAAGLK
LVNNRWVDVDWLSLESTNTPGIHVLGDAIFPAPTMPKSGHMANQHAKLAAAAILNLLAGE
APNPNPVVMNTCYSFLSSTEACHVASIHQYDAEKKTVLPVPGSGGVSAVRSVAEAQFALG
WAKNIWADALA