Protein Info for Dsui_1519 in Dechlorosoma suillum PS

Annotation: phosphoribosylaminoimidazole synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 81% identical to PUR5_DECAR: Phosphoribosylformylglycinamidine cyclo-ligase (purM) from Dechloromonas aromatica (strain RCB)

KEGG orthology group: K01933, phosphoribosylformylglycinamidine cyclo-ligase [EC: 6.3.3.1] (inferred from 81% identity to dar:Daro_3174)

MetaCyc: 62% identical to phosphoribosylformylglycinamide cyclo-ligase (Escherichia coli K-12 substr. MG1655)
Phosphoribosylformylglycinamidine cyclo-ligase. [EC: 6.3.3.1]

Predicted SEED Role

"Phosphoribosylformylglycinamidine cyclo-ligase (EC 6.3.3.1)" in subsystem De Novo Purine Biosynthesis (EC 6.3.3.1)

MetaCyc Pathways

superpathway of histidine, purine, and pyrimidine biosynthesis (44/46 steps found)
superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
superpathway of purine nucleotides de novo biosynthesis II (24/26 steps found)
superpathway of 5-aminoimidazole ribonucleotide biosynthesis (6/6 steps found)
5-aminoimidazole ribonucleotide biosynthesis I (5/5 steps found)
5-aminoimidazole ribonucleotide biosynthesis II (5/5 steps found)

KEGG Metabolic Maps

Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QP55 at UniProt or InterPro

Protein Sequence (349 amino acids)

>Dsui_1519 phosphoribosylaminoimidazole synthetase (Dechlorosoma suillum PS)
MTQDTSKTSLSYRDAGVDIDAGDALVERIKPFAKKTMREGVLAGIGGFGALFEVPKKYKE
PVLVSGTDGVGTKLKLAFQLNRHDTVGIDLVAMSVNDILVQGAEPLFFLDYFACGKLSVD
AAADVIKGIATGCEQAGCALIGGETAEMPGMYPDGEYDLAGFAVGAAEKSKLIDGKSIVP
GDVVLGLGSHGAHSNGYSLVRKIIERSGADFNAKFDGEATLADAVMAPTRIYVKPLLALL
QTLPVKGMAHITGGGLTENVPRVLPENTVAILDKSSWQRPKLFDWLQAEGNVSDDEMHRV
FNCGIGMVVVVAQEHARQAIQLLQAAGEKVWQIGDIRARQGDEAQTQVN