Protein Info for Dsui_1517 in Dechlorosoma suillum PS

Annotation: DnaA regulatory inactivator Hda

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 227 TIGR03420: DnaA regulatory inactivator Hda" amino acids 7 to 220 (214 residues), 204.9 bits, see alignment E=6.3e-65 PF00308: Bac_DnaA" amino acids 85 to 201 (117 residues), 40.4 bits, see alignment E=1.6e-14

Best Hits

KEGG orthology group: K10763, DnaA-homolog protein (inferred from 64% identity to dar:Daro_3180)

Predicted SEED Role

"Chromosomal replication initiator protein DnaA" in subsystem DNA-replication

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QP53 at UniProt or InterPro

Protein Sequence (227 amino acids)

>Dsui_1517 DnaA regulatory inactivator Hda (Dechlorosoma suillum PS)
MLPPMRQLLLDLMPESPPSLANFVGDGNEEALAALADWFSGPQPLFLLWGEAGSGKSHLL
QASGLHYVDGAQDPLLAGAPAEAEGLAVDNVQALAEAGQIALFNHFNRLRLAVENGRPGK
LLVASDQPPAALQLREDLRTRLGSALIFRLRPLSDEEKLAALAAQAADRGLKLSREALTY
LMNRSSRDMRTLAALLAALDRYSLEHKRPITLPLLREVLQHAGDSTV